Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogenusing MBS649473 (36.78kD).)

Mouse anti-Human SORT1 Monoclonal Antibody | anti-SORT1 antibody

SORT1 (Sortilin, 100 kDa NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3)

Gene Names
SORT1; NT3; Gp95; LDLCQ6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SORT1; Monoclonal Antibody; SORT1 (Sortilin; 100 kDa NT Receptor; Glycoprotein 95; Gp95; Neurotensin Receptor 3; NT3; NTR3); Anti -SORT1 (Sortilin; anti-SORT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B3
Specificity
Recognizes human SORT1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI*
Applicable Applications for anti-SORT1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa203-300 from human SORT1 (NP_002950) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogenusing MBS649473 (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogenusing MBS649473 (36.78kD).)

Western Blot (WB)

(Western Blot analysis of SORT1 expression in human spleen using MBS649473.)

Western Blot (WB) (Western Blot analysis of SORT1 expression in human spleen using MBS649473.)

Testing Data

(Detection limit for recombinant GST tagged SORT1 is 0.1ng/ml using MBS649473 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SORT1 is 0.1ng/ml using MBS649473 as a capture antibody.)
Related Product Information for anti-SORT1 antibody
Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.
Product Categories/Family for anti-SORT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92,068 Da
NCBI Official Full Name
sortilin isoform 2
NCBI Official Synonym Full Names
sortilin 1
NCBI Official Symbol
SORT1
NCBI Official Synonym Symbols
NT3; Gp95; LDLCQ6
NCBI Protein Information
sortilin; NTR3; glycoprotein 95; 100 kDa NT receptor; neurotensin receptor 3
UniProt Protein Name
Sortilin
Protein Family
UniProt Gene Name
SORT1
UniProt Synonym Gene Names
Gp95; NT3; NTR3
UniProt Entry Name
SORT_HUMAN

NCBI Description

This gene encodes a protein that is a multi-ligand type-1 receptor with similarity to the yeast carboxypeptidase Y sorting receptor Vps10 protein. The encoded protein, a trans-Golgi network (TGN) transmembrane protein, binds a number of unrelated ligands that participate in a wide range of cellular processes; however, it lacks the typical features of a signalling receptor. In the TGN, furin mediates the activation of the mature binding form. The encoded protein consists of a large luminal domain, a single transmembrane segment and short C-terminal cytoplasmic tail. The luminal domain contains a cysteine-rich region similar to two corresponding segments in the yeast Vps10p; the cytoplasmic tail is similar to the corresponding segment of the cation-independent mannose 6-phosphate receptor and the tail also interacts with the VHS domains of GGA (Golgi-associated, gamma-adaptin homologous, ARF-interacting) proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi. Ref.10 Ref.11 Ref.12 Ref.14 Ref.16 Ref.18 Ref.19 Ref.21 Ref.22 Ref.23

Subunit structure: Interacts with LPL and SLC2A4

By similarity. Interacts with the cytosolic adapter proteins GGA1 and GGA2. Interacts with numerous ligands including the receptor-associated protein LRPAP1/RAP, GM2A, NTS and PSAP. Forms a complex with NGFR which binds specifically to the precursor forms of NGFB (proNGFB) and BDNF (proBDNF). Interacts with the Trk receptors NTRK1, NTRK2 and NTRK3; may regulate their anterograde axonal transport and signaling. Ref.1 Ref.8 Ref.9 Ref.11 Ref.12 Ref.15 Ref.16 Ref.20 Ref.21 Ref.23 Ref.31 Ref.33

Subcellular location: Membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein

Potential. Endosome membrane; Single-pass type I membrane protein

Potential. Golgi apparatus › Golgi stack membrane; Single-pass type I membrane protein

Potential. Nucleus membrane; Single-pass type I membrane protein

Potential. Cell membrane; Single-pass type I membrane protein; Extracellular side. Lysosome membrane; Single-pass type I membrane protein

Potential. Note: Localized to membranes of the endoplasmic reticulum, endosomes, Golgi stack, lysosomes and nucleus. A small fraction of the protein is also localized to the plasma membrane. May also be found in SLC2A4/GLUT4 storage vesicles (GSVs) in adipocytes. Localization to the plasma membrane in adipocytes may be enhanced by insulin. Ref.1 Ref.16 Ref.18 Ref.19 Ref.20

Tissue specificity: Expressed at high levels in brain, spinal cord, heart, skeletal muscle, thyroid, placenta and testis. Expressed at lower levels in lymphoid organs, kidney, colon and liver. Ref.1

Induction: During osteoblast differentiation. Ref.14

Domain: The N-terminal propeptide may facilitate precursor transport within the Golgi stack. Intrachain binding of the N-terminal propeptide and the extracellular domain may also inhibit premature ligand binding. Ref.13The extracellular domain may be shed following protease cleavage in some cell types. Ref.13

Post-translational modification: The N-terminal propeptide is cleaved by furin and possibly other homologous proteases. Ref.8 Ref.13

Polymorphism: Genetic variations in SORT1 influence low density lipoprotein cholesterol (LDL-C) variability and contribute to the low density lipoprotein cholesterol level quantitative trait locus 6 (LDLCQ6) [

MIM:613589].

Involvement in disease: A common polymorphism located in a non-coding region between CELSR2 and PSRC1 alters a CEBP transcription factor binding site and is responsible for changes in hepatic expression of SORT1. Altered SORT1 expression in liver affects low density lipoprotein cholesterol levels in plasma and is associated with susceptibility to myocardial infarction.

Sequence similarities: Belongs to the VPS10-related sortilin family. SORT1 subfamily.Contains 9 BNR repeats.

Research Articles on SORT1

Similar Products

Product Notes

The SORT1 sort1 (Catalog #AAA649473) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SORT1 (Sortilin, 100 kDa NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SORT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SORT1 sort1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FAKNFVQTDL PFHPLTQMMY SPQNSDYLLA LSTENGLWVS KNFGGKWEEI HKAVCLAKWG SDNTIFFTTY ANGSCKADLG ALELWRTSDL GKSFKTI*. It is sometimes possible for the material contained within the vial of "SORT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.