Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SOD1 expression in transfected 293T cell line using. Lane 1: SOD1 transfected lysate (Predicted MW: 15.9kDa). Lane 2: Non-transfected lysate.)

Mouse SOD1 Monoclonal Antibody | anti-SOD1 antibody

SOD1 (Superoxide Dismutase 1, Soluble, ALS, ALS1, IPOA, SOD, Homodimer) (HRP)

Gene Names
SOD1; ALS; SOD; ALS1; IPOA; STAHP; hSod1; HEL-S-44; homodimer
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
SOD1; Monoclonal Antibody; SOD1 (Superoxide Dismutase 1; Soluble; ALS; ALS1; IPOA; SOD; Homodimer) (HRP); Superoxide Dismutase 1; Homodimer; anti-SOD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
10D5
Specificity
Recognizes human SOD1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
154
Applicable Applications for anti-SOD1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-154 of human SOD1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SOD1 expression in transfected 293T cell line using. Lane 1: SOD1 transfected lysate (Predicted MW: 15.9kDa). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SOD1 expression in transfected 293T cell line using. Lane 1: SOD1 transfected lysate (Predicted MW: 15.9kDa). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for is ~0.1ng/ml as a capture antibody.)

Testing Data

Testing Data

Testing Data

Testing Data
Related Product Information for anti-SOD1 antibody
The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene. [provided by RefSeq]
Product Categories/Family for anti-SOD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Superoxide dismutase 1, soluble
NCBI Official Synonym Full Names
superoxide dismutase 1
NCBI Official Symbol
SOD1
NCBI Official Synonym Symbols
ALS; SOD; ALS1; IPOA; STAHP; hSod1; HEL-S-44; homodimer
NCBI Protein Information
superoxide dismutase [Cu-Zn]
Protein Family

NCBI Description

The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene. [provided by RefSeq, Jul 2008]

Research Articles on SOD1

Similar Products

Product Notes

The SOD1 (Catalog #AAA6183055) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SOD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOD1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.