Testing Data
(Detection limit for recombinant GST tagged SNX24 is 3ng/ml as a capture antibody.)
Mouse anti-Human SNX24 Monoclonal Antibody | anti-SNX24 antibody
SNX24 (Sorting Nexin-24, SBBI31, UNQ654/PRO1284) (PE)
Gene Names
SNX24; SBBI31; PRO1284
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNX24; Monoclonal Antibody; SNX24 (Sorting Nexin-24; SBBI31; UNQ654/PRO1284) (PE); anti-SNX24 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A11
Specificity
Recognizes human SNX24.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1464
Applicable Applications for anti-SNX24 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-170 from human SNX24 (AAH10886) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged SNX24 is 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SNX24 is 3ng/ml as a capture antibody.)
Related Product Information for anti-SNX24 antibody
May be involved in several stages of intracellular trafficking.
Product Categories/Family for anti-SNX24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens sorting nexin 24, mRNA
NCBI Official Synonym Full Names
sorting nexin 24
NCBI Official Symbol
SNX24
NCBI Official Synonym Symbols
SBBI31; PRO1284
NCBI Protein Information
sorting nexin-24
Protein Family
Similar Products
Product Notes
The SNX24 (Catalog #AAA6160423) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SNX24 (Sorting Nexin-24, SBBI31, UNQ654/PRO1284) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNX24 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNX24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNX24, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
