Mouse anti-Human SNX1 Monoclonal Antibody | anti-SNX1 antibody

SNX1 (Sorting Nexin-1, MGC8664) (Biotin)

Cat. Num. AAA6144507

• Gene Names: SNX1; VPS5; HsT17379
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SNX1; Monoclonal Antibody; SNX1 (Sorting Nexin-1; MGC8664) (Biotin); anti-SNX1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6H1
• Specificity: Recognizes human SNX1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SNX1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa166-276 from human SNX1 (NP_003090) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVG*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(SNX1 monoclonal antibody, Western Blot analysis of SNX1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of SNX1 expression in transfected 293T cell line by SNX1 monoclonal antibody. Lane 1: SNX1 transfected lysate (59.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SNX1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SNX1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of SNX1 over-expressed 293 cell line, cotransfected with SNX1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SNX1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-SNX1 antibody

Antibodies; SNX Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 23111034
• NCBI GeneID: 6642
• NCBI Accession #: NP_003090
• NCBI GenBank Nucleotide #: NM_003099
• UniProt Accession #: Q13596; O60750; O60751; Q6ZRJ8; A6NM19; A8K6T7; H0Y2M5
• Molecular Weight: 48.0 kDa (415aa), confirmed by MALDI-TOF
• NCBI Official Full Name: sorting nexin-1 isoform a
• NCBI Official Synonym Full Names: sorting nexin 1
• NCBI Official Symbol: SNX1
• NCBI Official Synonym Symbols: VPS5; HsT17379
• NCBI Protein Information: sorting nexin-1
• UniProt Protein Name: Sorting nexin-1
• Protein Family: Sorting nexin
• UniProt Gene Name: SNX1
• UniProt Entry Name: SNX1_HUMAN

NCBI Description

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. This protein also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members. This gene results in three transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

SNX1: May be involved in several stages of intracellular trafficking. Plays a role in targeting ligand-activated EGFR to the lysosomes for degradation after endocytosis from the cell surface and release from the Golgi. Component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Interacts with membranes containing phosphatidylinositol 3- phosphate (PtdIns(3P)) or phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Belongs to the sorting nexin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 15q22.31

Cellular Component: Golgi apparatus; extrinsic to membrane; protein complex; membrane; intracellular membrane-bound organelle; retromer complex; early endosome membrane; lamellipodium; cytoplasm; endosome membrane; cytosol

Molecular Function: identical protein binding; protein binding; phosphoinositide binding; insulin receptor binding; epidermal growth factor receptor binding

Biological Process: intracellular protein transport; receptor internalization; vesicle organization and biogenesis; positive regulation of protein catabolic process; retrograde transport, endosome to Golgi