Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (66.37kD).)

Mouse anti-Human SMS Monoclonal Antibody | anti-SMS antibody

SMS (Spermine Synthase, SPMSY, Spermidine Aminopropyltransferase) (AP)

Gene Names
SMS; SRS; SpS; MRSR; SPMSY
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMS; Monoclonal Antibody; SMS (Spermine Synthase; SPMSY; Spermidine Aminopropyltransferase) (AP); anti-SMS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G6
Specificity
Recognizes human SMS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SMS antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-367 from human SMS (AAH09898) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (66.37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (66.37kD).)

Western Blot (WB)

(Western Blot analysis of SMS expression in transfected 293T cell line by SMS monoclonal antibody. Lane 1: SMS transfected lysate (41.268kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SMS expression in transfected 293T cell line by SMS monoclonal antibody. Lane 1: SMS transfected lysate (41.268kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SMS is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SMS is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-SMS antibody
The protein encoded by this gene belongs to the spermidine/spermine synthases family. This gene encodes an ubiquitous enzyme of polyamine metabolism.
Product Categories/Family for anti-SMS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
35,278 Da
NCBI Official Full Name
Homo sapiens spermine synthase, mRNA
NCBI Official Synonym Full Names
spermine synthase
NCBI Official Symbol
SMS
NCBI Official Synonym Symbols
SRS; SpS; MRSR; SPMSY
NCBI Protein Information
spermine synthase
UniProt Protein Name
Spermidine synthase
UniProt Gene Name
SRM
UniProt Synonym Gene Names
SPS1; SRML1; SPDSY
UniProt Entry Name
SPEE_HUMAN

NCBI Description

This gene encodes a protein belonging to the spermidine/spermin synthase family. Pseudogenes of this gene are located on chromosomes 1, 5, 6 and X. Mutations in this gene are associated with X-linked Snyder-Robinson mental retardation syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]

Uniprot Description

SRM: Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine. Belongs to the spermidine/spermine synthase family.

Protein type: Amino Acid Metabolism - arginine and proline; Other Amino Acids Metabolism - glutathione; EC 2.5.1.16; Amino Acid Metabolism - cysteine and methionine; Other Amino Acids Metabolism - beta-alanine; Transferase

Chromosomal Location of Human Ortholog: 1p36-p22

Cellular Component: cytosol

Molecular Function: protein homodimerization activity; spermidine synthase activity

Biological Process: spermidine biosynthetic process; polyamine metabolic process

Research Articles on SMS

Similar Products

Product Notes

The SMS srm (Catalog #AAA6133879) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMS (Spermine Synthase, SPMSY, Spermidine Aminopropyltransferase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMS srm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.