Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.03kD).)

Mouse anti-Human SMOC1 Monoclonal Antibody | anti-SMOC1 antibody

SMOC1 (SPARC-Related Modular Calcium-Binding Protein 1, Secreted Modular Calcium-Binding Protein 1, SMOC-1)

Gene Names
SMOC1; OAS
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SMOC1; Monoclonal Antibody; SMOC1 (SPARC-Related Modular Calcium-Binding Protein 1; Secreted Modular Calcium-Binding Protein 1; SMOC-1); Anti -SMOC1 (SPARC-Related Modular Calcium-Binding Protein 1; anti-SMOC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8F10
Specificity
Recognizes human SMOC1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS
Applicable Applications for anti-SMOC1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa150-222 from human SMOC1 (NP_071420) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.03kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.03kD).)

Western Blot (WB)

(SMOC1 monoclonal antibody, Western Blot analysis of SMOC1 expression in A-431.)

Western Blot (WB) (SMOC1 monoclonal antibody, Western Blot analysis of SMOC1 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of SMOC1 expression in transfected 293T cell line by SMOC1 monoclonal antibody.|Lane 1: SMOC1 transfected lysate (48.3kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SMOC1 expression in transfected 293T cell line by SMOC1 monoclonal antibody.|Lane 1: SMOC1 transfected lysate (48.3kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMOC1 on A-431 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMOC1 on A-431 cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SMOC1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SMOC1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-SMOC1 antibody
Plays essential roles in both eye and limb development. Probale regulator of osteoblast differentiation.
Product Categories/Family for anti-SMOC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,163 Da
NCBI Official Full Name
SPARC-related modular calcium-binding protein 1 isoform 1
NCBI Official Synonym Full Names
SPARC related modular calcium binding 1
NCBI Official Symbol
SMOC1
NCBI Official Synonym Symbols
OAS
NCBI Protein Information
SPARC-related modular calcium-binding protein 1; secreted modular calcium-binding protein 1
UniProt Protein Name
SPARC-related modular calcium-binding protein 1
UniProt Gene Name
SMOC1
UniProt Synonym Gene Names
SMOC-1
UniProt Entry Name
SMOC1_HUMAN

NCBI Description

This gene encodes a multi-domain secreted protein that may have a critical role in ocular and limb development. Mutations in this gene are associated with microphthalmia and limb anomalies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

Function: Plays essential roles in both eye and limb development. Probable regulator of osteoblast differentiation. Ref.6 Ref.7 Ref.8

Subcellular location: Secreted › extracellular space › extracellular matrix › basement membrane. Note: In or around the basement membrane. Ref.1 Ref.6

Tissue specificity: Widely expressed in many tissues with a strongest signal in ovary. No expression in spleen. Ref.1

Post-translational modification: Glycosylated. Ref.1

Involvement in disease: Ophthalmoacromelic syndrome (OAS) [MIM:206920]: A rare disorder presenting with ocular anomalies, ranging from mild microphthalmia to true anophthalmia, and limb anomalies. Limb malformations include fused 4th and 5th metacarpals and short 5th finger in hands, and oligodactyly in foot (four toes). Most patients have bilateral anophthalmia/ microphthalmia, but unilateral abnormality is also noted. Other malformations are rare, but venous or vertebral anomaly was recognized each in single cases.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.7 Ref.8 Ref.9 Ref.10

Sequence similarities: Contains 2 EF-hand domains.Contains 1 Kazal-like domain.Contains 2 thyroglobulin type-1 domains.

Research Articles on SMOC1

Similar Products

Product Notes

The SMOC1 smoc1 (Catalog #AAA648224) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMOC1 (SPARC-Related Modular Calcium-Binding Protein 1, Secreted Modular Calcium-Binding Protein 1, SMOC-1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMOC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the SMOC1 smoc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SVQNKTPVCS GSVTDKPLSQ GNSGRKDDGS KPTPTMETQP VFDGDEITAP TLWIKHLVIK DSKLNNTNIR NS. It is sometimes possible for the material contained within the vial of "SMOC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.