Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMAD3 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse SMAD3 Monoclonal Antibody | anti-SMAD3 antibody

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (Biotin)

Gene Names
SMAD3; LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SMAD3; Monoclonal Antibody; SMAD3 (SMAD Family Member 3; DKFZp586N0721; DKFZp686J10186; HSPC193; HsT17436; JV15-2; MADH3; MGC60396) (Biotin); SMAD Family Member 3; MGC60396; anti-SMAD3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C11
Specificity
Recognizes SMAD3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SMAD3 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMAD3 (NP_005893, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMAD3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMAD3 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(SMAD3 monoclonal antibody (M09), clone 1C11 Western Blot analysis of SMAD3 expression in Hela S3 NE.)

Western Blot (WB) (SMAD3 monoclonal antibody (M09), clone 1C11 Western Blot analysis of SMAD3 expression in Hela S3 NE.)

Western Blot (WB)

(SMAD3 monoclonal antibody (M09), clone 1C11. Western Blot analysis of SMAD3 expression in Jurkat.)

Western Blot (WB) (SMAD3 monoclonal antibody (M09), clone 1C11. Western Blot analysis of SMAD3 expression in Jurkat.)

Western Blot (WB)

(SMAD3 monoclonal antibody (M09), clone 1C11. Western Blot analysis of SMAD3 expression in SJCRH30.)

Western Blot (WB) (SMAD3 monoclonal antibody (M09), clone 1C11. Western Blot analysis of SMAD3 expression in SJCRH30.)

Testing Data

(Detection limit for recombinant GST tagged SMAD3 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SMAD3 is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-SMAD3 antibody
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq]
Product Categories/Family for anti-SMAD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50.2 kDa (445aa), confirmed by MALDI-TOF.
NCBI Official Full Name
mothers against decapentaplegic homolog 3 isoform 1
NCBI Official Synonym Full Names
SMAD family member 3
NCBI Official Symbol
SMAD3
NCBI Official Synonym Symbols
LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
NCBI Protein Information
mothers against decapentaplegic homolog 3
UniProt Protein Name
Mothers against decapentaplegic homolog 3
UniProt Gene Name
SMAD3
UniProt Synonym Gene Names
MADH3; MAD homolog 3; Mad3; Mothers against DPP homolog 3; hMAD-3; SMAD 3; Smad3; hSMAD3
UniProt Entry Name
SMAD3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq, Apr 2009]

Uniprot Description

SMAD3: transcription factor phosphorylated and activated by TGF-beta-type receptors. A receptor-regulated Smad (R-smad). Binds directly to consensus DNA-binding elements in the promoters of target genes. In mouse required for establishemnt of the mucosal immune response and proper development of skeleton.

Protein type: DNA-binding; Transcription factor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 15q22.33

Cellular Component: nucleoplasm; transcription factor complex; nuclear chromatin; cytoplasm; plasma membrane; nuclear inner membrane; cytosol; nucleus; receptor complex

Molecular Function: identical protein binding; ubiquitin binding; protein homodimerization activity; zinc ion binding; chromatin DNA binding; beta-catenin binding; protein kinase binding; transcription factor binding; phosphatase binding; transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity; collagen binding; protein binding; sequence-specific DNA binding; ubiquitin protein ligase binding; double-stranded DNA binding; bHLH transcription factor binding; transforming growth factor beta receptor binding; transcription factor activity

Biological Process: developmental growth; positive regulation of positive chemotaxis; positive regulation of transcription, DNA-dependent; activin receptor signaling pathway; paraxial mesoderm morphogenesis; embryonic pattern specification; regulation of transforming growth factor beta receptor signaling pathway; transforming growth factor beta receptor signaling pathway; positive regulation of stress fiber formation; embryonic foregut morphogenesis; negative regulation of mitotic cell cycle; negative regulation of osteoblast differentiation; cell cycle arrest; regulation of striated muscle development; pericardium development; somitogenesis; transcription, DNA-dependent; embryonic cranial skeleton morphogenesis; osteoblast development; regulation of transcription from RNA polymerase II promoter; positive regulation of chondrocyte differentiation; mesoderm formation; negative regulation of osteoblast proliferation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein catabolic process; endoderm development; negative regulation of apoptosis; evasion of host defenses by virus; wound healing; T cell activation; negative regulation of transcription from RNA polymerase II promoter; primary microRNA processing; regulation of epithelial cell proliferation; positive regulation of focal adhesion formation; negative regulation of protein amino acid phosphorylation; ureteric bud development; transport; positive regulation of transforming growth factor-beta3 production; thyroid gland development; positive regulation of transcription factor import into nucleus; heart looping; caspase activation; transcription initiation from RNA polymerase II promoter; intercellular junction assembly and maintenance; regulation of transforming growth factor-beta2 production; regulation of immune response; regulation of binding; protein stabilization; in utero embryonic development; positive regulation of bone mineralization; liver development; SMAD protein complex assembly; immune system development; positive regulation of interleukin-1 beta production; negative regulation of inflammatory response; response to hypoxia; gene expression; immune response; negative regulation of cell growth; negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of cell migration

Disease: Loeys-dietz Syndrome 3

Research Articles on SMAD3

Similar Products

Product Notes

The SMAD3 smad3 (Catalog #AAA6170467) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMAD3 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD3 smad3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.