Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SLMAP on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Mouse anti-Human SLMAP Monoclonal Antibody | anti-SLMAP antibody

SLMAP (Sarcolemmal Membrane-Associated Protein, Sarcolemmal-Associated Protein, KIAA1601, SLAP, UNQ1847/PRO3577, FLJ42206, MGC138760, MGC138761)

Gene Names
SLMAP; SLAP
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLMAP; Monoclonal Antibody; SLMAP (Sarcolemmal Membrane-Associated Protein; Sarcolemmal-Associated Protein; KIAA1601; SLAP; UNQ1847/PRO3577; FLJ42206; MGC138760; MGC138761); Anti -SLMAP (Sarcolemmal Membrane-Associated Protein; anti-SLMAP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A7
Specificity
Recognizes human SLMAP.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPW
Applicable Applications for anti-SLMAP antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Immunohistochemistry and Western Blot.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa677-785 from human SLMAP (NP_009090) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SLMAP on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SLMAP on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Western Blot (WB)

(SLMAP monoclonal antibody Western Blot analysis of SLMAP expression in A-431)

Western Blot (WB) (SLMAP monoclonal antibody Western Blot analysis of SLMAP expression in A-431)

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)
Product Categories/Family for anti-SLMAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95,198 Da
NCBI Official Full Name
sarcolemmal membrane-associated protein
NCBI Official Synonym Full Names
sarcolemma associated protein
NCBI Official Symbol
SLMAP
NCBI Official Synonym Symbols
SLAP
NCBI Protein Information
sarcolemmal membrane-associated protein; Sarcolemmal-associated protein
UniProt Protein Name
Sarcolemmal membrane-associated protein
UniProt Gene Name
SLMAP
UniProt Synonym Gene Names
KIAA1601; SLAP; Sarcolemmal-associated protein
UniProt Entry Name
SLMAP_HUMAN

NCBI Description

This gene encodes a component of a conserved striatin-interacting phosphatase and kinase complex. Striatin family complexes participate in a variety of cellular processes including signaling, cell cycle control, cell migration, Golgi assembly, and apoptosis. The protein encoded by this gene is a coiled-coil, tail-anchored membrane protein with a single C-terminal transmembrane domain that is posttranslationally inserted into membranes. Mutations in this gene are associated with Brugada syndrome, a cardiac channelopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]

Uniprot Description

Function: May play a role during myoblast fusion

By similarity.

Subunit structure: Homodimer. Interacts with myosin

By similarity.

Subcellular location: Cell membrane › sarcolemma; Single-pass type IV membrane protein

By similarity. Cytoplasm › cytoskeleton › microtubule organizing center › centrosome

By similarity. Note: Membrane-associated. Distributed in the transverse tubules and near the junctional sarcoplasmic reticulum. Detected along the Z- and M-lines in cardiomyocytes. Centrosome. Localizes to the centrosomes in a microtubule- dependent manner

By similarity.

Sequence similarities: Belongs to the SLMAP family.Contains 1 FHA domain.

Sequence caution: The sequence AAQ88776.1 differs from that shown. Reason: Erroneous initiation. The sequence CAH10369.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on SLMAP

Similar Products

Product Notes

The SLMAP slmap (Catalog #AAA648230) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLMAP (Sarcolemmal Membrane-Associated Protein, Sarcolemmal-Associated Protein, KIAA1601, SLAP, UNQ1847/PRO3577, FLJ42206, MGC138760, MGC138761) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLMAP can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Immunohistochemistry and Western Blot. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the SLMAP slmap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LHNSQKQSLE LTSDLSILQM SRKELENQVG SLKEQHLRDS ADLKTLLSKA ENQAKDVQKE YEKTQTVLSE LKLKFEMTEQ EKQSITDELK QCKNNLKLLR EKGNNKPW. It is sometimes possible for the material contained within the vial of "SLMAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.