Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SLC6A5 Monoclonal Antibody | anti-SLC6A5 antibody

SLC6A5 (GLYT2, NET1, Sodium-and Chloride-dependent Glycine Transporter 2, Solute Carrier Family 6 Member 5)

Gene Names
SLC6A5; NET1; GLYT2; HKPX3; GLYT-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC6A5; Monoclonal Antibody; SLC6A5 (GLYT2; NET1; Sodium-and Chloride-dependent Glycine Transporter 2; Solute Carrier Family 6 Member 5); Anti -SLC6A5 (GLYT2; anti-SLC6A5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B3
Specificity
Recognizes human SLC6A5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIR
Applicable Applications for anti-SLC6A5 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa294-394 from SLC6A5 (NP_004202) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-SLC6A5 antibody
This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea.
Product Categories/Family for anti-SLC6A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,434 Da
NCBI Official Full Name
sodium- and chloride-dependent glycine transporter 2
NCBI Official Synonym Full Names
solute carrier family 6 (neurotransmitter transporter), member 5
NCBI Official Symbol
SLC6A5
NCBI Official Synonym Symbols
NET1; GLYT2; HKPX3; GLYT-2
NCBI Protein Information
sodium- and chloride-dependent glycine transporter 2; solute carrier family 6 (neurotransmitter transporter, glycine), member 5
UniProt Protein Name
Sodium- and chloride-dependent glycine transporter 2
UniProt Gene Name
SLC6A5
UniProt Synonym Gene Names
GLYT2; NET1; GlyT-2; GlyT2
UniProt Entry Name
SC6A5_HUMAN

NCBI Description

This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. [provided by RefSeq, Oct 2009]

Uniprot Description

SLC6A5: Terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. May be responsible for the termination of neurotransmission at strychnine-sensitive glycinergic synapses. Defects in SLC6A5 are the cause of hyperekplexia type 3 (HKPX3). HKPX3 is a neurologic disorder characterized by neonatal hypertonia, an exaggerated startle response to tactile or acoustic stimuli, and life- threatening neonatal apnea episodes. Notably, in some cases, symptoms resolved in the first year of life. Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A5 subfamily.

Protein type: Transporter, SLC family; Transporter; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: neurotransmitter:sodium symporter activity; glycine:sodium symporter activity

Biological Process: synaptic transmission; synaptic transmission, glycinergic; transport; neurotransmitter transport; transmembrane transport

Disease: Hyperekplexia 3

Research Articles on SLC6A5

Similar Products

Product Notes

The SLC6A5 slc6a5 (Catalog #AAA6000024) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC6A5 (GLYT2, NET1, Sodium-and Chloride-dependent Glycine Transporter 2, Solute Carrier Family 6 Member 5) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SLC6A5 slc6a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TLFYLFASFV SVLPWGSCNN PWNTPECKDK TKLLLDSCVI SDHPKIQIKN STFCMTAYPN VTMVNFTSQA NKTFVSGSEE YFKYFVLKIS AGIEYPGEIR. It is sometimes possible for the material contained within the vial of "SLC6A5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.