Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ANP32ASample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ANP32A Polyclonal Antibody | anti-ANP32A antibody

ANP32A Antibody - C-terminal region

Gene Names
ANP32A; LANP; MAPM; PP32; HPPCn; PHAP1; PHAPI; I1PP2A; C15orf1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ANP32A; Polyclonal Antibody; ANP32A Antibody - C-terminal region; anti-ANP32A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Sequence Length
167
Applicable Applications for anti-ANP32A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ANP32A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ANP32ASample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ANP32ASample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-ANP32A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Full Name
acidic leucine-rich nuclear phosphoprotein 32 family member A
NCBI Official Synonym Full Names
acidic nuclear phosphoprotein 32 family member A
NCBI Official Symbol
ANP32A
NCBI Official Synonym Symbols
LANP; MAPM; PP32; HPPCn; PHAP1; PHAPI; I1PP2A; C15orf1
NCBI Protein Information
acidic leucine-rich nuclear phosphoprotein 32 family member A
UniProt Protein Name
Acidic leucine-rich nuclear phosphoprotein 32 family member A
UniProt Gene Name
ANP32A
UniProt Synonym Gene Names
C15orf1; LANP; MAPM; PHAP1; pp32; LANP; PHAPI
UniProt Entry Name
AN32A_HUMAN

Uniprot Description

ANP32A: Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase- independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1- mediated transcriptional repression. Belongs to the ANP32 family.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: nucleoplasm; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; gene expression; nucleocytoplasmic transport

Research Articles on ANP32A

Similar Products

Product Notes

The ANP32A anp32a (Catalog #AAA3220449) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANP32A Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANP32A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANP32A anp32a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEDVSGEEEE DEEGYNDGEV DDEEDEEELG EEERGQKRKR EPEDEGEDDD. It is sometimes possible for the material contained within the vial of "ANP32A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.