Mouse anti-Human SLC6A4 Monoclonal Antibody | anti-SLC6A4 antibody

SLC6A4 (Solute Carrier Family 6 Member 4, Sodium-dependent Serotonin Transporter, 5HT Transporter, 5HTT, HTT, SERT) APC

Cat. Num. AAA6139144

• Gene Names: SLC6A4; HTT; 5HTT; OCD1; SERT; 5-HTT; SERT1; hSERT; 5-HTTLPR
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC6A4; Monoclonal Antibody; SLC6A4 (Solute Carrier Family 6 Member 4; Sodium-dependent Serotonin Transporter; 5HT Transporter; 5HTT; HTT; SERT) APC; anti-SLC6A4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A9
• Specificity: Recognizes human SLC6A4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 630

• Applicable Applications for anti-SLC6A4 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa181-253 from human SLC6A4 (NP_001036) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC6A4 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-SLC6A4 antibody

Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.

Product Categories/Family for anti-SLC6A4 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 4507043
• NCBI GeneID: 6532
• NCBI Accession #: NP_001036
• NCBI GenBank Nucleotide #: NM_001045
• UniProt Accession #: P31645
• NCBI Official Full Name: sodium-dependent serotonin transporter
• NCBI Official Synonym Full Names: solute carrier family 6 member 4
• NCBI Official Symbol: SLC6A4
• NCBI Official Synonym Symbols: HTT; 5HTT; OCD1; SERT; 5-HTT; SERT1; hSERT; 5-HTTLPR
• NCBI Protein Information: sodium-dependent serotonin transporter
• UniProt Protein Name: Sodium-dependent serotonin transporter
• UniProt Gene Name: SLC6A4
• UniProt Synonym Gene Names: HTT; SERT; 5HTT
• UniProt Entry Name: SC6A4_HUMAN

NCBI Description

This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake. There have been conflicting results in the literature about the possible effect, if any, that this polymorphism may play in behavior and depression. [provided by RefSeq, May 2019]

Uniprot Description

SERT: Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner. Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A4 subfamily.

Protein type: Transporter; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: neuron projection; integral to plasma membrane; plasma membrane; endomembrane system; endosome membrane; cytosol; lipid raft

Molecular Function: actin filament binding; serotonin transmembrane transporter activity; protein binding; protein homodimerization activity; serotonin:sodium symporter activity; myosin binding; cocaine binding; monoamine transmembrane transporter activity; syntaxin-1 binding; nitric-oxide synthase binding; Rab GTPase binding

Biological Process: circadian rhythm; response to drug; vasoconstriction; response to toxin; monoamine transport; positive regulation of cell cycle; thalamus development; social behavior; serotonin uptake; negative regulation of organ growth; negative regulation of synaptic transmission, dopaminergic; protein oligomerization; memory; response to estradiol stimulus; negative regulation of granule cell precursor proliferation; negative regulation of neuron differentiation; response to hypoxia; brain morphogenesis; sperm ejaculation; serotonin transport; transmembrane transport; response to nutrient; protein homooligomerization

Disease: Obsessive-compulsive Disorder; Anxiety