Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC39A10 Monoclonal Antibody | anti-SLC39A10 antibody

SLC39A10 (Solute Carrier Family 39 Member 10, KIAA1265, LZT-Hs2, Zinc Transporter ZIP10, Zrt- and Irt-like Protein 10, ZIP10, ZIP-10) (MaxLight 405)

Gene Names
SLC39A10; LZT-Hs2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC39A10; Monoclonal Antibody; SLC39A10 (Solute Carrier Family 39 Member 10; KIAA1265; LZT-Hs2; Zinc Transporter ZIP10; Zrt- and Irt-like Protein 10; ZIP10; ZIP-10) (MaxLight 405); anti-SLC39A10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F6
Specificity
Recognizes human SLC39A10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-SLC39A10 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa514-622 from human SLC39A10 (NP_065075) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIHEHDL
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC39A10 antibody
MaxLight405 is a new Violet photostable dye conjugate comparable to Alexa Fluor 405, PacificBlue, Brilliant Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (400nm); Emission (423nm); Extinction Coefficient 32,000.
Product Categories/Family for anti-SLC39A10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
zinc transporter ZIP10
NCBI Official Synonym Full Names
solute carrier family 39 member 10
NCBI Official Symbol
SLC39A10
NCBI Official Synonym Symbols
LZT-Hs2
NCBI Protein Information
zinc transporter ZIP10
UniProt Protein Name
Zinc transporter ZIP10
Protein Family
UniProt Gene Name
SLC39A10
UniProt Synonym Gene Names
KIAA1265; ZIP10; ZIP-10
UniProt Entry Name
S39AA_HUMAN

NCBI Description

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).[supplied by OMIM, Mar 2008]

Uniprot Description

SLC39A10: May act as a zinc-influx transporter. Belongs to the ZIP transporter (TC 2.A.5) family.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Transporter; Transporter, SLC family; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q32.3

Cellular Component: integral to membrane

Molecular Function: metal ion transmembrane transporter activity

Biological Process: zinc ion transport; transmembrane transport

Research Articles on SLC39A10

Similar Products

Product Notes

The SLC39A10 slc39a10 (Catalog #AAA6192691) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC39A10 (Solute Carrier Family 39 Member 10, KIAA1265, LZT-Hs2, Zinc Transporter ZIP10, Zrt- and Irt-like Protein 10, ZIP10, ZIP-10) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC39A10 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC39A10 slc39a10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC39A10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.