Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLC37A4 is 0.03 ng/ml as a capture antibody.)

Mouse SLC37A4 Monoclonal Antibody | anti-SLC37A4 antibody

SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4, G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, MGC15729, PRO0685, TRG19) (APC)

Gene Names
SLC37A4; G6PT1; G6PT2; G6PT3; GSD1b; GSD1c; GSD1d; TRG19; TRG-19; PRO0685
Applications
Western Blot
Purity
Purified
Synonyms
SLC37A4; Monoclonal Antibody; SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter); Member 4; G6PT1; G6PT2; G6PT3; GSD1b; GSD1c; GSD1d; MGC15729; PRO0685; TRG19) (APC); Solute Carrier Family 37 (Glucose-6-Phosphate Transporter); TRG19; anti-SLC37A4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7B9
Specificity
Recognizes SLC37A4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
429
Applicable Applications for anti-SLC37A4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SLC37A4 (NP_001458.1, 28aa-76aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC37A4 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC37A4 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-SLC37A4 antibody
This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum. Mutations in this gene have been associated with various forms of glycogen storage disease. Alternative splicing in this gene results in multiple transcript variants.
Product Categories/Family for anti-SLC37A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
glucose-6-phosphate exchanger SLC37A4 isoform 1
NCBI Official Synonym Full Names
solute carrier family 37 member 4
NCBI Official Symbol
SLC37A4
NCBI Official Synonym Symbols
G6PT1; G6PT2; G6PT3; GSD1b; GSD1c; GSD1d; TRG19; TRG-19; PRO0685
NCBI Protein Information
glucose-6-phosphate exchanger SLC37A4
UniProt Protein Name
Glucose-6-phosphate translocase
UniProt Gene Name
SLC37A4
UniProt Synonym Gene Names
G6PT; G6PT1; PRO0685; TRG19; TRG-19
UniProt Entry Name
G6PT1_HUMAN

NCBI Description

This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum. Mutations in this gene have been associated with various forms of glycogen storage disease. Alternative splicing in this gene results in multiple transcript variants.[provided by RefSeq, Aug 2009]

Research Articles on SLC37A4

Similar Products

Product Notes

The SLC37A4 slc37a4 (Catalog #AAA6170190) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC37A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC37A4 slc37a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC37A4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.