Mouse anti-Human, Rat SLC29A4 Monoclonal Antibody | anti-SLC29A4 antibody

SLC29A4 (Solute Carrier Family 29 Member 4, Equilibrative Nucleoside Transporter 4, ENT4, hENT4, Plasma Membrane Monoamine Transporter, PMAT, PSEC0113) (FITC)

Cat. Num. AAA6149726

• Gene Names: SLC29A4; ENT4; PMAT
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC29A4; Monoclonal Antibody; SLC29A4 (Solute Carrier Family 29 Member 4; Equilibrative Nucleoside Transporter 4; ENT4; hENT4; Plasma Membrane Monoamine Transporter; PMAT; PSEC0113) (FITC); anti-SLC29A4 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6B6
• Specificity: Recognizes human SLC29A4. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 5664

• Applicable Applications for anti-SLC29A4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit for recombinant GST tagged SLC29A4 is ~0.3ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa283-346 from human SLC29A4 (NP_694979) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.04kD).)

Western Blot (WB)

(SLC29A4 monoclonal antibody Western Blot analysis of SLC29A4 expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged SLC29A4 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-SLC29A4 antibody

Antibodies; Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1677498918
• NCBI GeneID: 222962
• NCBI Accession #: NM_153247.3
• NCBI GenBank Nucleotide #: NM_153247
• UniProt Accession #: Q7RTT9
• NCBI Official Full Name: Homo sapiens solute carrier family 29 member 4 (SLC29A4), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: solute carrier family 29 member 4
• NCBI Official Symbol: SLC29A4
• NCBI Official Synonym Symbols: ENT4; PMAT
• NCBI Protein Information: equilibrative nucleoside transporter 4
• UniProt Protein Name: Equilibrative nucleoside transporter 4
• Protein Family: Equilibrative nucleoside transporter
• UniProt Gene Name: SLC29A4
• UniProt Synonym Gene Names: ENT4; PMAT; hENT4
• UniProt Entry Name: S29A4_HUMAN

NCBI Description

This gene encodes a member of the SLC29A/ENT transporter protein family. The encoded membrane protein catalyzes the reuptake of monoamines into presynaptic neurons, thus determining the intensity and duration of monoamine neural signaling. It has been shown to transport several compounds, including serotonin, dopamine, and the neurotoxin 1-methyl-4-phenylpyridinium. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

SLC29A4: Functions as a polyspecific organic cation transporter, efficiently transporting many organic cations such as monoamine neurotransmitters 1-methyl-4-phenylpyridinium and biogenic amines including serotonin, dopamine, norepinephrine and epinephrine. May play a role in regulating central nervous system homeostasis of monoamine neurotransmitters. May be involved in luminal transport of organic cations in the kidney and seems to use luminal proton gradient to drive organic cation reabsorption. Does not seem to transport nucleoside and nucleoside analogs such as uridine, cytidine, thymidine, adenosine, inosine, guanosine, and azidothymidine. In (PubMed:16873718) adenosine is efficiently transported but in a fashion highly sensitive to extracellular pH, with maximal activity in the pH range 5.5 to 6.5. Glu-206 is essential for the cation selectivity and may function as the charge sensor for cationic substrates. Transport is chloride and sodium-independent but appears to be sensitive to changes in membrane potential. Weakly inhibited by the classical inhibitors of equilibrative nucleoside transport, dipyridamole, dilazep, and nitrobenzylthioinosine. May play a role in the regulation of extracellular adenosine concentrations in cardiac tissues, in particular during ischemia. Belongs to the SLC29A/ENT transporter (TC 2.A.57) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 7p22.1

Cellular Component: apical plasma membrane; integral to membrane; plasma membrane

Molecular Function: nucleoside transmembrane transporter activity; monoamine transmembrane transporter activity

Biological Process: monoamine transport; transmembrane transport