Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.04kD).)

Mouse anti-Human, Rat SLC29A4 Monoclonal Antibody | anti-SLC29A4 antibody

SLC29A4 (Solute Carrier Family 29 Member 4, Equilibrative Nucleoside Transporter 4, ENT4, hENT4, Plasma Membrane Monoamine Transporter, PMAT, PSEC0113) APC

Gene Names
SLC29A4; ENT4; PMAT
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC29A4; Monoclonal Antibody; SLC29A4 (Solute Carrier Family 29 Member 4; Equilibrative Nucleoside Transporter 4; ENT4; hENT4; Plasma Membrane Monoamine Transporter; PMAT; PSEC0113) APC; anti-SLC29A4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B6
Specificity
Recognizes human SLC29A4. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
5664
Applicable Applications for anti-SLC29A4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit for recombinant GST tagged SLC29A4 is ~0.3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa283-346 from human SLC29A4 (NP_694979) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.04kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.04kD).)

Western Blot (WB)

(SLC29A4 monoclonal antibody Western Blot analysis of SLC29A4 expression in PC-12.)

Western Blot (WB) (SLC29A4 monoclonal antibody Western Blot analysis of SLC29A4 expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged SLC29A4 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC29A4 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC29A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens solute carrier family 29 member 4 (SLC29A4), transcript variant 2, mRNA
NCBI Official Synonym Full Names
solute carrier family 29 member 4
NCBI Official Symbol
SLC29A4
NCBI Official Synonym Symbols
ENT4; PMAT
NCBI Protein Information
equilibrative nucleoside transporter 4
UniProt Protein Name
Equilibrative nucleoside transporter 4
UniProt Gene Name
SLC29A4
UniProt Synonym Gene Names
ENT4; PMAT; hENT4
UniProt Entry Name
S29A4_HUMAN

NCBI Description

This gene encodes a member of the SLC29A/ENT transporter protein family. The encoded membrane protein catalyzes the reuptake of monoamines into presynaptic neurons, thus determining the intensity and duration of monoamine neural signaling. It has been shown to transport several compounds, including serotonin, dopamine, and the neurotoxin 1-methyl-4-phenylpyridinium. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

SLC29A4: Functions as a polyspecific organic cation transporter, efficiently transporting many organic cations such as monoamine neurotransmitters 1-methyl-4-phenylpyridinium and biogenic amines including serotonin, dopamine, norepinephrine and epinephrine. May play a role in regulating central nervous system homeostasis of monoamine neurotransmitters. May be involved in luminal transport of organic cations in the kidney and seems to use luminal proton gradient to drive organic cation reabsorption. Does not seem to transport nucleoside and nucleoside analogs such as uridine, cytidine, thymidine, adenosine, inosine, guanosine, and azidothymidine. In (PubMed:16873718) adenosine is efficiently transported but in a fashion highly sensitive to extracellular pH, with maximal activity in the pH range 5.5 to 6.5. Glu-206 is essential for the cation selectivity and may function as the charge sensor for cationic substrates. Transport is chloride and sodium-independent but appears to be sensitive to changes in membrane potential. Weakly inhibited by the classical inhibitors of equilibrative nucleoside transport, dipyridamole, dilazep, and nitrobenzylthioinosine. May play a role in the regulation of extracellular adenosine concentrations in cardiac tissues, in particular during ischemia. Belongs to the SLC29A/ENT transporter (TC 2.A.57) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 7p22.1

Cellular Component: apical plasma membrane; integral to membrane; plasma membrane

Molecular Function: nucleoside transmembrane transporter activity; monoamine transmembrane transporter activity

Biological Process: monoamine transport; transmembrane transport

Research Articles on SLC29A4

Similar Products

Product Notes

The SLC29A4 slc29a4 (Catalog #AAA6139120) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC29A4 (Solute Carrier Family 29 Member 4, Equilibrative Nucleoside Transporter 4, ENT4, hENT4, Plasma Membrane Monoamine Transporter, PMAT, PSEC0113) APC reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC29A4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit for recombinant GST tagged SLC29A4 is ~0.3ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC29A4 slc29a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC29A4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.