Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC28A2 Monoclonal Antibody | anti-SLC28A2 antibody

SLC28A2 (Solute Carrier Family 28 Member 2, Sodium/Nucleoside Cotransporter 2, Na(+)/Nucleoside Cotransporter 2, Sodium-coupled Nucleoside Transporter 2, Concentrative Nucleoside Transporter 2, CNT 2, rCNT2, Sodium/Purine Nucleoside Co-transporter, SPNT,

Gene Names
SLC28A2; CNT2; HCNT2; SPNT1; HsT17153
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC28A2; Monoclonal Antibody; SLC28A2 (Solute Carrier Family 28 Member 2; Sodium/Nucleoside Cotransporter 2; Na(+)/Nucleoside Cotransporter 2; Sodium-coupled Nucleoside Transporter 2; Concentrative Nucleoside Transporter 2; CNT 2; rCNT2; Sodium/Purine Nucleoside Co-transporter; SPNT; ; anti-SLC28A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D3
Specificity
Recognizes human SLC28A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
4371
Applicable Applications for anti-SLC28A2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-80 from SLC28A2 (NP_004203) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHARLFKK
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC28A2 antibody
SLC28A2 regulates adenosine transport across the blood-brain barrier into the brain.
Product Categories/Family for anti-SLC28A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens solute carrier family 28 member 2 (SLC28A2), mRNA
NCBI Official Synonym Full Names
solute carrier family 28 member 2
NCBI Official Symbol
SLC28A2
NCBI Official Synonym Symbols
CNT2; HCNT2; SPNT1; HsT17153
NCBI Protein Information
sodium/nucleoside cotransporter 2
UniProt Protein Name
Sodium/nucleoside cotransporter 2
UniProt Gene Name
SLC28A2
UniProt Synonym Gene Names
CNT2; CNT 2; hCNT2; SPNT
UniProt Entry Name
S28A2_HUMAN

Uniprot Description

SLC28A2: Sodium-dependent and purine-selective transporter. Exhibits the transport characteristics of the nucleoside transport system cif or N1 subtype (N1/cif) (selective for purine nucleosides and uridine). Plays a critical role in specific uptake and salvage of purine nucleosides in kidney and other tissues. Belongs to the concentrative nucleoside transporter (CNT) (TC 2.A.41) family.

Protein type: Transporter, SLC family; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 15q15

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: purine nucleoside transmembrane transporter activity; nucleoside:sodium symporter activity; nucleoside binding

Biological Process: nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; purine nucleoside transport; transmembrane transport

Research Articles on SLC28A2

Similar Products

Product Notes

The SLC28A2 slc28a2 (Catalog #AAA6224705) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC28A2 (Solute Carrier Family 28 Member 2, Sodium/Nucleoside Cotransporter 2, Na(+)/Nucleoside Cotransporter 2, Sodium-coupled Nucleoside Transporter 2, Concentrative Nucleoside Transporter 2, CNT 2, rCNT2, Sodium/Purine Nucleoside Co-transporter, SPNT, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC28A2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC28A2 slc28a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC28A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.