Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- LIFR Picoband antibody, MBS177717, Western blottingAll lanes: Anti LIFR (MBS177717) at 0.5ug/mlLane 1: SW620 Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 190KDObserved bind size: 190KD )

anti-Human LIFR Polyclonal Antibody | anti-LIFR antibody

Anti-LIFR Antibody

Gene Names
LIFR; SWS; SJS2; STWS; CD118; LIF-R
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
LIFR; Polyclonal Antibody; Anti-LIFR Antibody; Leukemia inhibitory factor receptor; CD118; CD118 antigen; FLJ98106; FLJ99923; Leukemia inhibitory factor receptor alpha; LIF R; LIF receptor; LIF-R; Lifr; LIFR_HUMAN; SJS2; STWS; SWS; leukemia inhibitory factor receptor alpha; anti-LIFR antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1097
Applicable Applications for anti-LIFR antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- LIFR Picoband antibody, MBS177717, Western blottingAll lanes: Anti LIFR (MBS177717) at 0.5ug/mlLane 1: SW620 Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 190KDObserved bind size: 190KD )

Western Blot (WB) (Anti- LIFR Picoband antibody, MBS177717, Western blottingAll lanes: Anti LIFR (MBS177717) at 0.5ug/mlLane 1: SW620 Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 190KDObserved bind size: 190KD )
Related Product Information for anti-LIFR antibody
Description: Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.

Background: LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.
References
1. "Entrez Gene: LIFR leukemia inhibitory factor receptor alpha". 2. Lass A, Weiser W, Munafo A, Loumaye E (2002). "Leukemia inhibitory factor in human reproduction". Fertil. Steril. 76 (6): 1091-6. 3. Tomida M (2003). "Structural and functional studies on the leukemia inhibitory factor receptor (LIF-R): gene and soluble form of LIF-R, and cytoplasmic domain of LIF-R required for differentiation and growth arrest of myeloid leukemic cells.". Leuk. Lymphoma 37 (5-6): 517-25.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
– Da
NCBI Official Full Name
leukemia inhibitory factor receptor
NCBI Official Synonym Full Names
leukemia inhibitory factor receptor alpha
NCBI Official Symbol
LIFR
NCBI Official Synonym Symbols
SWS; SJS2; STWS; CD118; LIF-R
NCBI Protein Information
leukemia inhibitory factor receptor
UniProt Protein Name
Leukemia inhibitory factor receptor
UniProt Gene Name
LIFR
UniProt Synonym Gene Names
LIF receptor; LIF-R
UniProt Entry Name
LIFR_HUMAN

NCBI Description

This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

LIFR: Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells. Defects in LIFR are the cause of Stueve-Wiedemann syndrome (SWS); also knowns as Schwartz-Jampel syndrome type 2 (SJS2). SWS is a severe autosomal recessive condition and belongs to the group of the bent-bone dysplasias. SWS is characterized by bowing of the lower limbs, with internal cortical thickening, wide metaphyses with abnormal trabecular pattern, and camptodactyly. Additional features include feeding and swallowing difficulties, as well as respiratory distress and hyperthermic episodes, which cause death in the first months of life. The rare survivors develop progressive scoliosis, spontaneous fractures, bowing of the lower limbs, with prominent joints and dysautonomia symptoms, including temperature instability, absent corneal and patellar reflexes, and smooth tongue. A chromosomal aberration involving LIFR is found in salivary gland pleiomorphic adenomas, the most common benign epithelial tumors of the salivary gland. Translocation t(5;8)(p13;q12) with PLAG1. Belongs to the type I cytokine receptor family. Type 2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 5p13-p12

Cellular Component: integral to plasma membrane; plasma membrane; receptor complex

Molecular Function: ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; cytokine binding; growth factor binding; leukemia inhibitory factor receptor activity; oncostatin-M receptor activity; protein heterodimerization activity

Biological Process: cell surface receptor linked signal transduction; cytokine and chemokine mediated signaling pathway; leukemia inhibitory factor signaling pathway; neurite morphogenesis; organ regeneration; positive regulation of cell proliferation; response to cytokine stimulus; response to organic cyclic substance

Disease: Stuve-wiedemann Syndrome

Research Articles on LIFR

Similar Products

Product Notes

The LIFR lifr (Catalog #AAA177717) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-LIFR Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LIFR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the LIFR lifr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LIFR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.