Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human SLC26A3 Monoclonal Antibody | anti-SLC26A3 antibody

SLC26A3 (Chloride Anion Exchanger, Down-regulated in Adenoma, Protein DRA, Solute Carrier Family 26 Member 3, DRA) (PE)

Gene Names
SLC26A3; CLD; DRA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC26A3; Monoclonal Antibody; SLC26A3 (Chloride Anion Exchanger; Down-regulated in Adenoma; Protein DRA; Solute Carrier Family 26 Member 3; DRA) (PE); anti-SLC26A3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E3
Specificity
Recognizes human SLC26A3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SLC26A3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.8ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa503-600 from human SLC26A3 (NP_000102) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SLC26A3 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.8ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SLC26A3 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.8ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SLC26A3 is 0.3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged SLC26A3 is 0.3ng/ml as a capture antibody)
Product Categories/Family for anti-SLC26A3 antibody
References
1. ION TRANSPORT MECHANISMS LINKED TO BICARBONATE SECRETION IN THE ESOPHAGEAL SUBMUCOSAL GLANDS. Abdulnour-Nakhoul S, Nakhoul HN, Kalliny MI, Gyftopoulos A, Rabon E, Doetjes R, Brown K, Nakhoul NL.Am J Physiol Regul Integr Comp Physiol. 2011 Apr 6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
chloride anion exchanger
NCBI Official Synonym Full Names
solute carrier family 26 member 3
NCBI Official Symbol
SLC26A3
NCBI Official Synonym Symbols
CLD; DRA
NCBI Protein Information
chloride anion exchanger
UniProt Protein Name
Chloride anion exchanger
Protein Family
UniProt Gene Name
SLC26A3
UniProt Synonym Gene Names
DRA; Protein DRA

NCBI Description

The protein encoded by this gene is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea. [provided by RefSeq, Oct 2008]

Uniprot Description

Chloride/bicarbonate exchanger. Mediates the efficient absorption of chloride ions in the colon, participating in fluid homeostasis. Plays a role in the chloride and bicarbonate homeostasis during sperm epididymal maturation and capacitation.

Research Articles on SLC26A3

Similar Products

Product Notes

The SLC26A3 slc26a3 (Catalog #AAA6160324) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC26A3 (Chloride Anion Exchanger, Down-regulated in Adenoma, Protein DRA, Solute Carrier Family 26 Member 3, DRA) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC26A3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.8ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC26A3 slc26a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC26A3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.