Mouse anti-Human SLC25A21 Monoclonal Antibody | anti-SLC25A21 antibody

SLC25A21 (Mitochondrial 2-oxodicarboxylate Carrier, Solute Carrier Family 25 Member 21, ODC) (Biotin)

Cat. Num. AAA6144408

• Gene Names: SLC25A21; ODC; ODC1
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC25A21; Monoclonal Antibody; SLC25A21 (Mitochondrial 2-oxodicarboxylate Carrier; Solute Carrier Family 25 Member 21; ODC) (Biotin); anti-SLC25A21 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C9
• Specificity: Recognizes human SLC25A21.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SLC25A21 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa36-100 from human SLC25A21 (NP_085134) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC25A21 is 1ng/ml as a capture antibody.)

Related Product Information for anti-SLC25A21 antibody

Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate.

Product Categories/Family for anti-SLC25A21 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 13449279
• NCBI GeneID: 89874
• NCBI Accession #: NP_085134.1
• NCBI GenBank Nucleotide #: NM_030631
• UniProt Accession #: Q9BQT8; Q3MJ99; A8K0L0; G3V4L5
• Molecular Weight: 33,117 Da
• NCBI Official Full Name: mitochondrial 2-oxodicarboxylate carrier isoform 1
• NCBI Official Synonym Full Names: solute carrier family 25 (mitochondrial oxoadipate carrier), member 21
• NCBI Official Symbol: SLC25A21
• NCBI Official Synonym Symbols: ODC; ODC1
• NCBI Protein Information: mitochondrial 2-oxodicarboxylate carrier; solute carrier family 25 member 21; solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21
• UniProt Protein Name: Mitochondrial 2-oxodicarboxylate carrier
• Protein Family: Mitochondrial 2-oxodicarboxylate carrier
• UniProt Gene Name: SLC25A21
• UniProt Synonym Gene Names: ODC
• UniProt Entry Name: ODC_HUMAN

NCBI Description

SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.[supplied by OMIM, Apr 2004]

Uniprot Description

SLC25A21: Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2- oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate. Belongs to the mitochondrial carrier family.

Protein type: Membrane protein, multi-pass; Transporter; Membrane protein, integral; Mitochondrial; Transporter, SLC family

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: mitochondrial inner membrane; integral to membrane

Biological Process: lysine catabolic process; transmembrane transport