Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TAF4BSample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit TAF4B Polyclonal Antibody | anti-TAF4B antibody

TAF4B Antibody - N-terminal region

Gene Names
TAF4B; SPGF13; TAF2C2; TAFII105
Reactivity
Cow, Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TAF4B; Polyclonal Antibody; TAF4B Antibody - N-terminal region; anti-TAF4B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPGKPLNTVTTLKPSSLGASSTPSNEPNLKAENSAAVQINLSPTMLENVK
Sequence Length
618
Applicable Applications for anti-TAF4B antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 92%; Horse: 92%; Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TAF4B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TAF4BSample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TAF4BSample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TAF4B antibody
This is a rabbit polyclonal antibody against TAF4B. It was validated on Western Blot

Target Description: TATA binding protein (TBP) and TBP-associated factors (TAFs) participate in the formation of the TFIID protein complex, which is involved in initiation of transcription of genes by RNA polymerase II. This gene encodes a cell type-specific TAF that may be responsible for mediating transcription by a subset of activators in B cells.
Product Categories/Family for anti-TAF4B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 4b
NCBI Official Symbol
TAF4B
NCBI Official Synonym Symbols
SPGF13; TAF2C2; TAFII105
NCBI Protein Information
transcription initiation factor TFIID subunit 4B
UniProt Protein Name
Transcription initiation factor TFIID subunit 4B
UniProt Gene Name
TAF4B
UniProt Synonym Gene Names
TAF2C2; TAFII105; TAF(II)105; TAFII-105; TAFII105
UniProt Entry Name
TAF4B_HUMAN

NCBI Description

TATA binding protein (TBP) and TBP-associated factors (TAFs) participate in the formation of the TFIID protein complex, which is involved in initiation of transcription of genes by RNA polymerase II. This gene encodes a cell type-specific TAF that may be responsible for mediating transcription by a subset of activators in B cells. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]

Uniprot Description

TAF4B: Cell type-specific subunit of TFIID that may function as a gene-selective coactivator in certain cells. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. TAFII105 is a transcriptional coactivator of the p65/RELA NF-kappa-B subunit. Involved in the activation of a subset of antiapoptotic genes including TNFAIP3. May be involved in regulating folliculogenesis. Through interaction with OCBA/POU2AF1, acts as a coactivator of B-cell-specific transcription. Belongs to the TAF4 family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 18q11.2

Cellular Component: nucleoplasm; transcription factor TFIID complex; cytoplasm; nucleolus

Molecular Function: NF-kappaB binding; DNA binding; protein heterodimerization activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; oogenesis; transcription initiation from RNA polymerase II promoter; regulation of transcription, DNA-dependent; viral reproduction; RNA elongation from RNA polymerase II promoter; spermatogenesis; gene expression

Disease: Spermatogenic Failure 13

Research Articles on TAF4B

Similar Products

Product Notes

The TAF4B taf4b (Catalog #AAA3219246) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF4B Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's TAF4B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAF4B taf4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPGKPLNTVT TLKPSSLGAS STPSNEPNLK AENSAAVQIN LSPTMLENVK. It is sometimes possible for the material contained within the vial of "TAF4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.