Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat SLC22A8 Monoclonal Antibody | anti-SLC22A8 antibody

SLC22A8 (Solute Carrier Family 22 Member 8, Organic Anion Transporter 3, OAT3, hOAT3) (MaxLight 550)

Gene Names
SLC22A8; OAT3
Reactivity
Human, Rat
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC22A8; Monoclonal Antibody; SLC22A8 (Solute Carrier Family 22 Member 8; Organic Anion Transporter 3; OAT3; hOAT3) (MaxLight 550); anti-SLC22A8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C11
Specificity
Recognizes human SLC22A8. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
2180
Applicable Applications for anti-SLC22A8 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa256-325 from SLC22A8 (NP_004245) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRR
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC22A8 antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-SLC22A8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens solute carrier family 22 member 8 (SLC22A8), transcript variant 1, mRNA
NCBI Official Synonym Full Names
solute carrier family 22 member 8
NCBI Official Symbol
SLC22A8
NCBI Official Synonym Symbols
OAT3
NCBI Protein Information
solute carrier family 22 member 8
UniProt Protein Name
Solute carrier family 22 member 8
Protein Family
UniProt Gene Name
SLC22A8
UniProt Synonym Gene Names
OAT3; hOAT3
UniProt Entry Name
S22A8_HUMAN

NCBI Description

This gene encodes a protein involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, May 2010]

Uniprot Description

SLC22A8: Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone- 3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA). Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Transporter, SLC family; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q11

Cellular Component: basolateral plasma membrane; plasma membrane; integral to membrane

Molecular Function: protein kinase C binding; inorganic anion exchanger activity; organic anion transmembrane transporter activity; quaternary ammonium group transmembrane transporter activity

Biological Process: quaternary ammonium group transport; response to toxin; response to methotrexate; transmembrane transport

Research Articles on SLC22A8

Similar Products

Product Notes

The SLC22A8 slc22a8 (Catalog #AAA6214010) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC22A8 (Solute Carrier Family 22 Member 8, Organic Anion Transporter 3, OAT3, hOAT3) (MaxLight 550) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A8 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC22A8 slc22a8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC22A8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.