Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.1KD).)

Mouse anti-Human SLC17A4 Monoclonal Antibody | anti-SLC17A4 antibody

SLC17A4 (Solute Carrier Family 17 Member 4, KAIA2138, Putative Small Intestine Sodium-dependent Phosphate Transport Protein)

Gene Names
SLC17A4; KAIA2138
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC17A4; Monoclonal Antibody; SLC17A4 (Solute Carrier Family 17 Member 4; KAIA2138; Putative Small Intestine Sodium-dependent Phosphate Transport Protein); Anti -SLC17A4 (Solute Carrier Family 17 Member 4; anti-SLC17A4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E4
Specificity
Recognizes human SLC17A4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
NLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYV
Applicable Applications for anti-SLC17A4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Dilution: ELISA: 1ng/ml
Immunogen
Partial recombinant corresponding to aa56-131 from SLC17A4 (NP_005486) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.1KD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.1KD).)

Western Blot (WB)

(SLC17A4 monoclonal antibody Western Blot analysis of SLC17A4 expression in K-562)

Western Blot (WB) (SLC17A4 monoclonal antibody Western Blot analysis of SLC17A4 expression in K-562)

Testing Data

(Detection limit for recombinant GST tagged SLC17A4 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC17A4 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC17A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
54,055 Da
NCBI Official Full Name
SLC17A4 protein
NCBI Official Synonym Full Names
solute carrier family 17, member 4
NCBI Official Symbol
SLC17A4
NCBI Official Synonym Symbols
KAIA2138
NCBI Protein Information
putative small intestine sodium-dependent phosphate transport protein; Na/PO4 cotransporter; solute carrier family 17 member 4; solute carrier family 17 (sodium phosphate), member 4
UniProt Protein Name
Putative small intestine sodium-dependent phosphate transport protein
UniProt Gene Name
SLC17A4
UniProt Entry Name
S17A4_HUMAN

NCBI Description

Phosphate homeostasis is maintained by regulating intake, intestinal absorption, bone deposition and resorption, and renal excretion of phosphate. The central molecule in the control of phosphate excretion from the kidney is the sodium/phosphate cotransporter NPT1 (SLC17A1; MIM 182308), which is located in the renal proximal tubule. NPT1 uses the transmembrane electrochemical potential gradient of sodium to transport phosphate across the cell membrane. SLC17A4 is a similar sodium/phosphate cotransporter in the intestinal mucosa that plays an important role in the absorption of phosphate from the intestine (summary by Shibui et al., 1999 [PubMed 10319585]).[supplied by OMIM, Feb 2011]

Uniprot Description

Function: May be involved in actively transporting phosphate into cells via Na+ cotransport

By similarity.

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Expressed intestine, colon, liver and pancreas. Ref.1

Sequence similarities: Belongs to the major facilitator superfamily. Sodium/anion cotransporter family.

Research Articles on SLC17A4

Similar Products

Product Notes

The SLC17A4 slc17a4 (Catalog #AAA649079) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC17A4 (Solute Carrier Family 17 Member 4, KAIA2138, Putative Small Intestine Sodium-dependent Phosphate Transport Protein) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC17A4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Dilution: ELISA: 1ng/ml. Researchers should empirically determine the suitability of the SLC17A4 slc17a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NLSIAIPAMV NNTAPPSQPN ASTERPSTDS QGYWNETLKE FKAMAPAYDW SPEIQGIILS SLNYGSFLAP IPSGYV. It is sometimes possible for the material contained within the vial of "SLC17A4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.