Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLC15A3 is 0.3 ng/ml as a capture antibody.)

Mouse SLC15A3 Monoclonal Antibody | anti-SLC15A3 antibody

SLC15A3 (Solute Carrier Family 15, Member 3, FLJ26631, OCTP, PHT2, PTR3, hPTR3) (Biotin)

Gene Names
SLC15A3; OCTP; PHT2; PTR3
Applications
Western Blot
Purity
Purified
Synonyms
SLC15A3; Monoclonal Antibody; SLC15A3 (Solute Carrier Family 15; Member 3; FLJ26631; OCTP; PHT2; PTR3; hPTR3) (Biotin); Solute Carrier Family 15; hPTR3; anti-SLC15A3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5B4
Specificity
Recognizes SLC15A3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SLC15A3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SLC15A3 (NP_057666.1, 254aa-311aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC15A3 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC15A3 is 0.3 ng/ml as a capture antibody.)

Western Blot (WB)

(SLC15A3 monoclonal antibody (M04), clone 5B4. Western Blot analysis of SLC15A3 expression in PC-12.)

Western Blot (WB) (SLC15A3 monoclonal antibody (M04), clone 5B4. Western Blot analysis of SLC15A3 expression in PC-12.)
Related Product Information for anti-SLC15A3 antibody
Mouse monoclonal antibody raised against a partial recombinant SLC15A3.
Product Categories/Family for anti-SLC15A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,560 Da
NCBI Official Full Name
solute carrier family 15 member 3
NCBI Official Synonym Full Names
solute carrier family 15 (oligopeptide transporter), member 3
NCBI Official Symbol
SLC15A3
NCBI Official Synonym Symbols
OCTP; PHT2; PTR3
NCBI Protein Information
solute carrier family 15 member 3; peptide transporter 3; osteoclast transporter; peptide/histidine transporter 2; solute carrier family 15, member 3
UniProt Protein Name
Solute carrier family 15 member 3
Protein Family
UniProt Gene Name
SLC15A3
UniProt Synonym Gene Names
OCTP; PHT2; PTR3
UniProt Entry Name
S15A3_HUMAN

Uniprot Description

Function: Proton oligopeptide cotransporter. Transports free histidine and certain di- and tripeptides

By similarity.

Subcellular location: Lysosome membrane; Multi-pass membrane protein Ref.5.

Sequence similarities: Belongs to the PTR2/POT transporter (TC 2.A.17) family. [View classification]

Research Articles on SLC15A3

Similar Products

Product Notes

The SLC15A3 slc15a3 (Catalog #AAA6174637) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC15A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC15A3 slc15a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC15A3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.