Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human SLC12A4 Monoclonal Antibody | anti-SLC12A4 antibody

SLC12A4 (Solute Carrier Family 12 Member 4, Electroneutral Potassium-chloride Cotransporter 1, Erythroid K-Cl Cotransporter 1, hKCC1, KCC1, FLJ40489) (PE)

Gene Names
SLC12A4; KCC1; hKCC1; CTC-479C5.17
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC12A4; Monoclonal Antibody; SLC12A4 (Solute Carrier Family 12 Member 4; Electroneutral Potassium-chloride Cotransporter 1; Erythroid K-Cl Cotransporter 1; hKCC1; KCC1; FLJ40489) (PE); anti-SLC12A4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H6
Specificity
Recognizes human SLC12A4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SLC12A4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human SLC12A4 (AAH21193) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(Western Blot analysis of SLC12A4 expression in transfected 293T cell line by SLC12A4 monoclonal antibody. Lane 1: SLC12A4 transfected lysate (120.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLC12A4 expression in transfected 293T cell line by SLC12A4 monoclonal antibody. Lane 1: SLC12A4 transfected lysate (120.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SLC12A4 antibody
Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May contribute to cell volume homeostasis in single cells. May be involved in the regulation of basolateral Cl- exit in NaCl absorbing epithelia. Isoform 4 has no transport activity.
Product Categories/Family for anti-SLC12A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
119,745 Da
NCBI Official Full Name
Homo sapiens solute carrier family 12 (potassium/chloride transporters), member 4, mRNA
NCBI Official Synonym Full Names
solute carrier family 12 member 4
NCBI Official Symbol
SLC12A4
NCBI Official Synonym Symbols
KCC1; hKCC1; CTC-479C5.17
NCBI Protein Information
solute carrier family 12 member 4
Protein Family

NCBI Description

This gene encodes a member of the SLC12A transporter family. The encoded protein mediates the coupled movement of potassium and chloride ions across the plasma membrane. This gene is expressed ubiquitously. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2013]

Research Articles on SLC12A4

Similar Products

Product Notes

The SLC12A4 (Catalog #AAA6160294) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC12A4 (Solute Carrier Family 12 Member 4, Electroneutral Potassium-chloride Cotransporter 1, Erythroid K-Cl Cotransporter 1, hKCC1, KCC1, FLJ40489) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC12A4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC12A4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC12A4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.