Cystathionine beta-synthase  Recombinant Protein | Cbs recombinant protein

Recombinant Mouse Cystathionine beta-synthase 

Cat. Num. AAA1366759

• Gene Names: Cbs; HIP4; AI047524; AI303044
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cystathionine beta-synthase ; Recombinant Mouse Cystathionine beta-synthase ; Beta-thionase; Serine sulfhydrase; Cbs recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-561aa; Full Length
• Sequence: PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT
• Sequence Length: 547

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Cbs recombinant protein

Only known pyridoxal phosphate-dependent enzyme that contains heme. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury

References

"The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y. Science 309:1559-1563(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 405778333
• NCBI GeneID: 12411
• NCBI Accession #: NP_001258282.1
• NCBI GenBank Nucleotide #: NM_001271353.1
• UniProt Accession #: Q91WT9; Q91WU3
• Molecular Weight: 63.4 kDa
• NCBI Official Full Name: cystathionine beta-synthase isoform 2
• NCBI Official Synonym Full Names: cystathionine beta-synthase
• NCBI Official Symbol: Cbs
• NCBI Official Synonym Symbols: HIP4; AI047524; AI303044
• NCBI Protein Information: cystathionine beta-synthase
• UniProt Protein Name: Cystathionine beta-synthase
• Protein Family: Cystathionine beta-synthase
• UniProt Gene Name: Cbs
• UniProt Entry Name: CBS_MOUSE

Uniprot Description

CBS: Only known pyridoxal phosphate-dependent enzyme that contains heme. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury. Defects in CBS are the cause of cystathionine beta- synthase deficiency (CBSD). CBSD is an enzymatic deficiency resulting in altered sulfur metabolism and homocystinuria. The clinical features of untreated homocystinuria due to CBS deficiency include myopia, ectopia lentis, mental retardation, skeletal anomalies resembling Marfan syndrome, and thromboembolic events. Light skin and hair can also be present. Biochemical features include increased urinary homocystine and methionine. Belongs to the cysteine synthase/cystathionine beta- synthase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 4.2.1.22; Amino Acid Metabolism - glycine, serine and threonine; Other Amino Acids Metabolism - selenoamino acid; Amino Acid Metabolism - cysteine and methionine; Lyase

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: cystathionine beta-synthase activity; cysteine synthase activity; enzyme binding; heme binding; identical protein binding; lyase activity; metal ion binding; nitrite reductase (NO-forming) activity; oxygen binding; protein homodimerization activity; pyridoxal phosphate binding; ubiquitin protein ligase binding

Biological Process: amino acid biosynthetic process; blood vessel remodeling; cerebellum morphogenesis; cysteine biosynthetic process; cysteine biosynthetic process from serine; cysteine biosynthetic process via cystathionine; endochondral ossification; homocysteine metabolic process; maternal process involved in pregnancy; negative regulation of apoptosis; regulation of blood vessel size; regulation of cGMP metabolic process; regulation of JNK activity; response to folic acid; superoxide metabolic process; transsulfuration