Testing Data
(Detection limit for recombinant GST tagged SLAMF7 is 1ng/ml as a capture antibody using.)
Mouse anti-Human SLAMF7 Monoclonal Antibody | anti-SLAMF7 antibody
SLAMF7 (CS1, SLAM Family Member 7, CD2 Subset 1, CD2-like Receptor-activating Cytotoxic Cells, CRACC, Membrane Protein FOAP-12, Novel Ly9, Protein 19A, CD319, UNQ576/PRO1138) (FITC)
Gene Names
SLAMF7; 19A; CS1; CD319; CRACC
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLAMF7; Monoclonal Antibody; SLAMF7 (CS1; SLAM Family Member 7; CD2 Subset 1; CD2-like Receptor-activating Cytotoxic Cells; CRACC; Membrane Protein FOAP-12; Novel Ly9; Protein 19A; CD319; UNQ576/PRO1138) (FITC); anti-SLAMF7 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B9
Specificity
Recognizes human SLAMF7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SLAMF7 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-297 from human SLAMF7 (AAH27867) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLPLVPLLLSLFVLGLFLWFLKRERQEENNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged SLAMF7 is 1ng/ml as a capture antibody using.)
Testing Data
(Detection limit for recombinant GST tagged SLAMF7 is 1ng/ml as a capture antibody using.)
Related Product Information for anti-SLAMF7 antibody
SLAMF7 contains one Ig-like C2-type (immunoglobulin-like) domain. Isoform 1 mediates NK cell activation through a SAP-independent extracellular signal-regulated ERK-mediated pathway. It may play a role in lymphocyte adhesion. Isoform 3 does not mediate any activation. SAP can bind the cytoplasmic tail of isoform 1 when phosphorylated in the presence of Fyn (in vitro). SLAMF7 is expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression was detected in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-, or T-cell lines. The isoform 3 is expressed at much lower level than isoform 1. There are three named isoforms.
Product Categories/Family for anti-SLAMF7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
21,316 Da
NCBI Official Full Name
Homo sapiens SLAM family member 7, mRNA
NCBI Official Synonym Full Names
SLAM family member 7
NCBI Official Symbol
SLAMF7
NCBI Official Synonym Symbols
19A; CS1; CD319; CRACC
NCBI Protein Information
SLAM family member 7
Protein Family
Research Articles on SLAMF7
Similar Products
Product Notes
The SLAMF7 (Catalog #AAA6149682) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLAMF7 (CS1, SLAM Family Member 7, CD2 Subset 1, CD2-like Receptor-activating Cytotoxic Cells, CRACC, Membrane Protein FOAP-12, Novel Ly9, Protein 19A, CD319, UNQ576/PRO1138) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLAMF7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLAMF7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLAMF7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
