Mouse SHP2/PTPN11 Monoclonal Antibody | anti-SHP2 antibody

Anti-SHP2/PTPN11 Antibody (monoclonal, 2E6)

Cat. Num. AAA1751917

• Gene Names: PTPN11; CFC; NS1; JMML; SHP2; BPTP3; PTP2C; METCDS; PTP-1D; SH-PTP2; SH-PTP3
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry
• Purity: Immunogen Affinity Purified
• Synonyms: SHP2/PTPN11; Monoclonal Antibody; Anti-SHP2/PTPN11 Antibody (monoclonal; 2E6); Tyrosine-protein phosphatase non-receptor type 11; Protein-tyrosine phosphatase 1D; PTP-1D; Protein-tyrosine phosphatase 2C; PTP-2C; SH-PTP2; SHP-2; Shp2; SH-PTP3; PTPN11; PTP2C; SHPTP2; Protein tyrosine phosphatase; non-receptor type 11; anti-SHP2 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2b
• Clone Number: 2E6
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized; Each vial contains 4mg Trehalose, 0.9mg NaCI, 0.2mg Na2HPO4, 0.05mg NaN3
• Sequence Length: 593

• Applicable Applications for anti-SHP2 antibody: Western Blot (WB), Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry
• Application Notes: WB: 0.1-0.5ug/ml; IHC-P: 0.5-1ug/ml; Antigen Retrieval: By heat; IHC-F: 0.5-1ug/ml; ICC/IF: 2ug/ml ; FC: 1-3ug/1x10⁶ cells; Tested Species: In-house tested species with positive results.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; ; Other applications have bot been tested.; Optimal dilutions should be determined by end users.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Relevant Detection Systems: It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG MBS176460 for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit MBS176453 for IHC-P and ICC.
• Preparation and Storage: Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.; Avoid repeated freezing and thawing.

Related Product Information for anti-SHP2 antibody

Description: Mouse IgG monoclonal antibody for SHP2/PTPN11 detection. Tested with WB, IHC-P, IHC-F, ICC/IF in Human; Mouse; Rat.
Background: PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1, 779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

References

1. Higashi, H., Tsutsumi, R., Muto, S., Sugiyama, T., Azuma, T, Asaka, M., Hatakeyama, M. SHP-2 tyrosine phosphatase as an intracellular target of Helicobacter pylori CagA protein. Science 295: 683-686, 2002.

NCBI and Uniprot Product Information

• NCBI GI #: 1059433492
• NCBI GeneID: 5781
• NCBI Accession #: NP_001317366.1
• NCBI GenBank Nucleotide #: NM_001330437.1
• UniProt Accession #: Q06124; Q96HD7; A8K1D9
• NCBI Official Full Name: tyrosine-protein phosphatase non-receptor type 11 isoform 3
• NCBI Official Synonym Full Names: protein tyrosine phosphatase, non-receptor type 11
• NCBI Official Symbol: PTPN11
• NCBI Official Synonym Symbols: CFC; NS1; JMML; SHP2; BPTP3; PTP2C; METCDS; PTP-1D; SH-PTP2; SH-PTP3
• NCBI Protein Information: tyrosine-protein phosphatase non-receptor type 11
• UniProt Protein Name: Tyrosine-protein phosphatase non-receptor type 11
• UniProt Gene Name: PTPN11
• UniProt Synonym Gene Names: PTP2C; SHPTP2; PTP-1D; PTP-2C; SHP-2; Shp2

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia. [provided by RefSeq, Aug 2016]

Uniprot Description

Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus. Positively regulates MAPK signal transduction pathway (PubMed:28074573). Dephosphorylates GAB1, ARHGAP35 and EGFR (PubMed:28074573). Dephosphorylates ROCK2 at 'Tyr-722' resulting in stimulatation of its RhoA binding activity. Dephosphorylates CDC73 (PubMed:26742426).