Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- SHP2 Picoband antibody, MBS178088, Western blottingAll lanes: Anti SHP2 (MBS178088) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: Rat Cardiac Muscle Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: SW620 Whole Cell Lysate at 40ugLane 7: HEPG2 Whole Cell Lysate at 40ugLane 8: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD )

SHP2 Polyclonal Antibody | anti-SHP2 antibody

Anti-SHP2 Antibody

Gene Names
PTPN11; CFC; NS1; JMML; SHP2; BPTP3; PTP2C; METCDS; PTP-1D; SH-PTP2; SH-PTP3
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
SHP2; Polyclonal Antibody; Anti-SHP2 Antibody; Tyrosine-protein phosphatase non-receptor type 11; BPTP 3; BPTP3; CFC; MGC14433; Noonan syndrome 1; Noonan syndrome 1 protein tyrosine phosphatase 2C; NS 1; NS1; OTTHUMP00000166107; OTTHUMP00000166108; Protein tyrosine phosphatase 2; Protein tyrosine phosphatase 2C; Protein Tyrosine Phosphatase Non receptor Type 11; Protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; PTN11_HUMAN; PTP 1D; PTP 2C; PTP-1D; PTP-2C; PTP1D; PTP2C; PTPN 11; PTPN11; SAP2; SH PTP2; SH PTP3; SH-PTP2; SH-PTP3; SH2 domain containing protein tyrosine phosphatase 2; SHIP2; SHP 2; SHP-2; Shp2; SHPTP 2; SHPTP2; SHPTP3; SIT protein precursor; Syp; Tyrosine protein phosphatase non receptor type 11; Tyrosine-protein phosphatase non-receptor type 11 antibody; protein tyrosine phosphatase; non-receptor type 11; anti-SHP2 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
593
Applicable Applications for anti-SHP2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- SHP2 Picoband antibody, MBS178088, Western blottingAll lanes: Anti SHP2 (MBS178088) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: Rat Cardiac Muscle Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: SW620 Whole Cell Lysate at 40ugLane 7: HEPG2 Whole Cell Lysate at 40ugLane 8: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD )

Western Blot (WB) (Anti- SHP2 Picoband antibody, MBS178088, Western blottingAll lanes: Anti SHP2 (MBS178088) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: Rat Cardiac Muscle Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: SW620 Whole Cell Lysate at 40ugLane 7: HEPG2 Whole Cell Lysate at 40ugLane 8: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD )

Immunohistochemistry (IHC)

(Anti- SHP2 Picoband antibody, MBS178088,IHC(P)IHC(P): Mouse Cardiac Muscle Tissue )

Immunohistochemistry (IHC) (Anti- SHP2 Picoband antibody, MBS178088,IHC(P)IHC(P): Mouse Cardiac Muscle Tissue )

Immunohistochemistry (IHC)

(Anti- SHP2 Picoband antibody, MBS178088,IHC(P)IHC(P): Rat Skeletal Muscle Tissue )

Immunohistochemistry (IHC) (Anti- SHP2 Picoband antibody, MBS178088,IHC(P)IHC(P): Rat Skeletal Muscle Tissue )

Immunohistochemistry (IHC)

(Anti- SHP2 Picoband antibody, MBS178088,IHC(P)IHC(P): Human Lung Cancer Tissue )

Immunohistochemistry (IHC) (Anti- SHP2 Picoband antibody, MBS178088,IHC(P)IHC(P): Human Lung Cancer Tissue )
Related Product Information for anti-SHP2 antibody
Description: Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1,779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
References
1. Higashi, H., Tsutsumi, R., Muto, S., Sugiyama, T., Azuma, T, Asaka, M., Hatakeyama, M. SHP-2 tyrosine phosphatase as an intracellular target of Helicobacter pylori CagA protein. Science 295: 683-686, 2002.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,828 Da
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 11 isoform 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 11
NCBI Official Symbol
PTPN11
NCBI Official Synonym Symbols
CFC; NS1; JMML; SHP2; BPTP3; PTP2C; METCDS; PTP-1D; SH-PTP2; SH-PTP3
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 11
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 11
UniProt Gene Name
PTPN11
UniProt Synonym Gene Names
PTP2C; SHPTP2; PTP-1D; PTP-2C; SHP-2; Shp2
UniProt Entry Name
PTN11_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]

Uniprot Description

SHP-2: a SH2-containing a ubiquitously expressed tyrosine-specific protein phosphatase. It participates in signaling events downstream of receptors for growth factors, cytokines, hormones, antigens and extracellular matrices in the control of cell growth, differentiation, migration, and death. Activation of SHP-2 and its association with Gab1 is critical for sustained Erk activation downstream of several growth factor receptors and cytokines.

Protein type: Protein phosphatase, tyrosine (non-receptor); EC 3.1.3.48; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12q24

Cellular Component: cytoplasm; cytosol; mitochondrion; nucleus; protein complex

Molecular Function: 1-phosphatidylinositol-3-kinase activity; D1 dopamine receptor binding; insulin receptor binding; insulin receptor substrate binding; non-membrane spanning protein tyrosine phosphatase activity; peptide hormone receptor binding; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; phospholipase binding; phosphoprotein phosphatase activity; protein binding; protein domain specific binding; protein tyrosine phosphatase activity; receptor tyrosine kinase binding; SH3/SH2 adaptor activity

Biological Process: abortive mitotic cell cycle; activation of MAPK activity; axonogenesis; Bergmann glial cell differentiation; brain development; cerebellar cortex formation; DNA damage checkpoint; ephrin receptor signaling pathway; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; genitalia development; glucose homeostasis; heart development; homeostasis of number of cells within a tissue; hormone metabolic process; hormone-mediated signaling; inner ear development; integrin-mediated signaling pathway; leukocyte migration; microvillus organization and biogenesis; multicellular organism growth; negative regulation of cell adhesion mediated by integrin; negative regulation of cortisol secretion; negative regulation of growth hormone secretion; negative regulation of insulin secretion; nerve growth factor receptor signaling pathway; organ growth; phosphoinositide phosphorylation; phosphoinositide-mediated signaling; platelet activation; platelet formation; platelet-derived growth factor receptor signaling pathway; positive regulation of hormone secretion; positive regulation of mitotic cell cycle; regulation of cell adhesion mediated by integrin; regulation of multicellular organism growth; regulation of phosphoinositide 3-kinase cascade; regulation of protein complex assembly; regulation of protein export from nucleus; reproductive process in a multicellular organism; T cell costimulation; triacylglycerol metabolic process

Disease: Juvenile Myelomonocytic Leukemia; Leopard Syndrome 1; Metachondromatosis; Noonan Syndrome 1

Research Articles on SHP2

Similar Products

Product Notes

The SHP2 ptpn11 (Catalog #AAA178088) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SHP2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SHP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the SHP2 ptpn11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SHP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.