Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit is 0.3ng/ml using 133286 as a capture antibody.)

Mouse anti-Human SH2D1B Monoclonal Antibody | anti-SH2D1B antibody

SH2D1B (SH2 Domain-containing Protein 1B, EWS/FLI1-activated Transcript 2, EAT-2, EAT2) (MaxLight 650)

Gene Names
SH2D1B; EAT2
Reactivity
Human
Applications
Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SH2D1B; Monoclonal Antibody; SH2D1B (SH2 Domain-containing Protein 1B; EWS/FLI1-activated Transcript 2; EAT-2; EAT2) (MaxLight 650); anti-SH2D1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B4
Specificity
Recognizes human SH2D1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SH2D1B antibody
FLISA, Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa54-132 from human SH2D1B with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit is 0.3ng/ml using 133286 as a capture antibody.)

Testing Data (Detection limit is 0.3ng/ml using 133286 as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of SH2D1B transfected lysate using 133286 and Protein A Magnetic Bead and immunoblotted with SH2D1B rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SH2D1B transfected lysate using 133286 and Protein A Magnetic Bead and immunoblotted with SH2D1B rabbit polyclonal antibody.)
Related Product Information for anti-SH2D1B antibody
Plays a role in controlling signal transduction through at least four receptors, CD84, SLAMF1, LY9 and CD244, expressed on the surface of professional antigen-presenting cells.
Product Categories/Family for anti-SH2D1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,297 Da
NCBI Official Full Name
SH2 domain-containing protein 1B
NCBI Official Synonym Full Names
SH2 domain containing 1B
NCBI Official Symbol
SH2D1B
NCBI Official Synonym Symbols
EAT2
NCBI Protein Information
SH2 domain-containing protein 1B; EAT-2; EWS/FLI1-activated transcript 2; SH2 domain-containing molecule EAT2
UniProt Protein Name
SH2 domain-containing protein 1B
UniProt Gene Name
SH2D1B
UniProt Synonym Gene Names
EAT2; EAT-2
UniProt Entry Name
SH21B_HUMAN

NCBI Description

By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]).[supplied by OMIM, Mar 2008]

Uniprot Description

SH2D1B: Plays a role in controlling signal transduction through at least four receptors, CD84, SLAMF1, LY9 and CD244, expressed on the surface of professional antigen-presenting cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: intracellular

Molecular Function: protein binding, bridging; protein binding

Biological Process: leukocyte activation during immune response; positive regulation of innate immune response; positive regulation of natural killer cell mediated immunity

Research Articles on SH2D1B

Similar Products

Product Notes

The SH2D1B sh2d1b (Catalog #AAA6224613) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SH2D1B (SH2 Domain-containing Protein 1B, EWS/FLI1-activated Transcript 2, EAT-2, EAT2) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SH2D1B can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SH2D1B sh2d1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SH2D1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.