Mouse anti-Human SH2D1B Monoclonal Antibody | anti-SH2D1B antibody

SH2D1B (SH2 Domain-containing Protein 1B, EWS/FLI1-activated Transcript 2, EAT-2, EAT2) (FITC)

Cat. Num. AAA6149633

• Gene Names: SH2D1B; EAT2
• Reactivity: Human
• Applications: Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SH2D1B; Monoclonal Antibody; SH2D1B (SH2 Domain-containing Protein 1B; EWS/FLI1-activated Transcript 2; EAT-2; EAT2) (FITC); anti-SH2D1B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B4
• Specificity: Recognizes human SH2D1B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-SH2D1B antibody: FLISA, Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa54-132 from human SH2D1B with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit is 0.3ng/ml using 133286 as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of SH2D1B transfected lysate using 133286 and Protein A Magnetic Bead and immunoblotted with SH2D1B rabbit polyclonal antibody.)

Related Product Information for anti-SH2D1B antibody

Plays a role in controlling signal transduction through at least four receptors, CD84, SLAMF1, LY9 and CD244, expressed on the surface of professional antigen-presenting cells.

Product Categories/Family for anti-SH2D1B antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 54792745
• NCBI GeneID: 117157
• NCBI Accession #: NP_444512.2
• NCBI GenBank Nucleotide #: NM_053282
• UniProt Accession #: O14796; Q5T0L1; Q8NI18; Q969K9; B2RBN6
• Molecular Weight: 15,297 Da
• NCBI Official Full Name: SH2 domain-containing protein 1B
• NCBI Official Synonym Full Names: SH2 domain containing 1B
• NCBI Official Symbol: SH2D1B
• NCBI Official Synonym Symbols: EAT2
• NCBI Protein Information: SH2 domain-containing protein 1B; EAT-2; EWS/FLI1-activated transcript 2; SH2 domain-containing molecule EAT2
• UniProt Protein Name: SH2 domain-containing protein 1B
• Protein Family: SH2 domain-containing protein
• UniProt Gene Name: SH2D1B
• UniProt Synonym Gene Names: EAT2; EAT-2
• UniProt Entry Name: SH21B_HUMAN

NCBI Description

By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]).[supplied by OMIM, Mar 2008]

Uniprot Description

SH2D1B: Plays a role in controlling signal transduction through at least four receptors, CD84, SLAMF1, LY9 and CD244, expressed on the surface of professional antigen-presenting cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: intracellular

Molecular Function: protein binding, bridging; protein binding

Biological Process: leukocyte activation during immune response; positive regulation of innate immune response; positive regulation of natural killer cell mediated immunity