Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human SGCB Monoclonal Antibody | anti-SGCB antibody

SGCB (Beta-Sarcoglycan, Beta-SG, Sarcoglycan, beta, SGC, 43kD Dystrophin-associated Glycoprotein, 43DAG, A3b, LGMD2E) (AP)

Gene Names
SGCB; A3b; SGC; LGMD2E
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SGCB; Monoclonal Antibody; SGCB (Beta-Sarcoglycan; Beta-SG; Sarcoglycan; beta; SGC; 43kD Dystrophin-associated Glycoprotein; 43DAG; A3b; LGMD2E) (AP); anti-SGCB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C10
Specificity
Recognizes human SGCB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SGCB antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa87-197 from human SGCB (NP_000223) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVK*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(SGCB monoclonal antibody, Western Blot analysis of SGCB expression in MCF-7.)

Western Blot (WB) (SGCB monoclonal antibody, Western Blot analysis of SGCB expression in MCF-7.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SGCB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SGCB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SGCB on MCF-7 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SGCB on MCF-7 cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-SGCB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.8kDa (255aa)
NCBI Official Full Name
beta-sarcoglycan
NCBI Official Synonym Full Names
sarcoglycan beta
NCBI Official Symbol
SGCB
NCBI Official Synonym Symbols
A3b; SGC; LGMD2E
NCBI Protein Information
beta-sarcoglycan
UniProt Protein Name
Beta-sarcoglycan
Protein Family
UniProt Gene Name
SGCB
UniProt Synonym Gene Names
Beta-SG; 43DAG
UniProt Entry Name
SGCB_HUMAN

NCBI Description

This gene encodes a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix. Mutations in this gene have been associated with limb-girdle muscular dystrophy.[provided by RefSeq, Oct 2008]

Uniprot Description

SGCB: Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix. Defects in SGCB are the cause of limb-girdle muscular dystrophy type 2E (LGMD2E). LGMD2E is an autosomal recessive disorder. Belongs to the sarcoglycan beta/delta/gamma/zeta family.

Protein type: Dystrophin complex; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q12

Cellular Component: dystrophin-associated glycoprotein complex; integral to plasma membrane

Disease: Muscular Dystrophy, Limb-girdle, Type 2e

Research Articles on SGCB

Similar Products

Product Notes

The SGCB sgcb (Catalog #AAA6133715) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SGCB (Beta-Sarcoglycan, Beta-SG, Sarcoglycan, beta, SGC, 43kD Dystrophin-associated Glycoprotein, 43DAG, A3b, LGMD2E) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGCB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGCB sgcb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGCB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.