Mouse anti-Human SFPQ Monoclonal Antibody | anti-SFPQ antibody

SFPQ (Splicing Factor, Proline- and Glutamine-rich, 100kD DNA-pairing Protein, hPOMp100, DNA-binding p52/p100 Complex, 100kD Subunit, Polypyrimidine Tract-binding Protein-associated-splicing Factor, PSF, PTB-associated-splicing Fact, PSF) (PE)

Cat. Num. AAA6160221

• Gene Names: SFPQ; PSF; POMP100; PPP1R140
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SFPQ; Monoclonal Antibody; SFPQ (Splicing Factor; Proline- and Glutamine-rich; 100kD DNA-pairing Protein; hPOMp100; DNA-binding p52/p100 Complex; 100kD Subunit; Polypyrimidine Tract-binding Protein-associated-splicing Factor; PSF; PTB-associated-splicing Fact; PSF) (PE); anti-SFPQ antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6D7
• Specificity: Recognizes human SFPQ.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SFPQ antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa269-362 from human SFPQ (NP_005057) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.34kD).)

Western Blot (WB)

(SFRS3 monoclonal antibody, Western Blot analysis of SFRS3 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SFPQ on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SFPQ on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SFPQ is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-SFPQ antibody

Antibodies; Splicing Factors

References

1. Novel snail1 target proteins in human colon cancer identified by proteomic analysis. Larriba MJ, Casado-Vela J, Pendas-Franco N, Pena R, Garcia de Herreros A, Berciano MT, Lafarga M, Casal JI, Munoz A.PLoS One. 2010 Apr 20;5(4):e10221, 2. A cell-based screen for splicing regulators identifies hnRNP LL as a distinct signal-induced repressor of CD45 variable exon 4. Topp JD, Jackson J, Melton AA, Lynch KW.RNA. 2008 Oct;14(10):2038-49. Epub 2008 Aug 21, 3. Combinatorial Control of Signal-Induced Exon Repression by HnRNP L and PSF. Melton AA, Jackson J, Wang J, Lynch KW.Mol Cell Biol. 2007 Oct;27(19):6972-84. Epub 2007 Jul 30.

NCBI and Uniprot Product Information

• NCBI GI #: 4826998
• NCBI GeneID: 6421
• NCBI Accession #: NP_005057
• NCBI GenBank Nucleotide #: NM_005066
• UniProt Accession #: P23246; P30808; Q5SZ71
• Molecular Weight: 72,263 Da
• NCBI Official Full Name: splicing factor, proline- and glutamine-rich
• NCBI Official Synonym Full Names: splicing factor proline/glutamine-rich
• NCBI Official Symbol: SFPQ
• NCBI Official Synonym Symbols: PSF; POMP100; PPP1R140
• NCBI Protein Information: splicing factor, proline- and glutamine-rich; 100 kDa DNA-pairing protein; DNA-binding p52/p100 complex, 100 kDa subunit; PTB-associated splicing factor; PTB-associated-splicing factor; hPOMp100; polypyrimidine tract binding protein associated; polypyrimi
• UniProt Protein Name: Splicing factor, proline- and glutamine-rich
• Protein Family: Splicing factor
• UniProt Gene Name: SFPQ
• UniProt Synonym Gene Names: PSF; hPOMp100; PSF; PTB-associated-splicing factor
• UniProt Entry Name: SFPQ_HUMAN

Uniprot Description

PSF: a proline-and glutamine-rich splicing factor. Essential pre-mRNA splicing factor required early in spliceosome formation. Seems to also bind DNA. The active complex is a heterotetramer of two 52 kDa and two 100 kDa subunits. Reported to be a PKC-alpha-binding protein in the cell nucleus. Two alternatively spliced isoforms have been described.

Protein type: RNA splicing; RNA-binding; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: nucleoplasm; nuclear matrix; cytoplasm; nucleus; paraspeckles; chromatin

Molecular Function: protein binding; histone deacetylase binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; RNA splicing; rhythmic process; negative regulation of circadian rhythm; negative regulation of transcription from RNA polymerase II promoter; DNA repair; mRNA processing; negative regulation of transcription, DNA-dependent; regulation of circadian rhythm; DNA recombination