Mouse SFPQ Monoclonal Antibody | anti-SFPQ antibody

SFPQ (Splicing Factor Proline/Glutamine-Rich (polypyrimidine tract Binding Protein Associated), POMP100, PSF) (Biotin)

Cat. Num. AAA6172735

• Gene Names: SFPQ; PSF; POMP100; PPP1R140
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: SFPQ; Monoclonal Antibody; SFPQ (Splicing Factor Proline/Glutamine-Rich (polypyrimidine tract Binding Protein Associated); POMP100; PSF) (Biotin); Splicing Factor Proline/Glutamine-Rich (polypyrimidine tract Binding Protein Associated); PSF; anti-SFPQ antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B10
• Specificity: Recognizes SFPQ.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SFPQ antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SFPQ (NP_005057, 269aa-361aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SFPQ monoclonal antibody (M01), clone 3B10. Western Blot analysis of SFPQ expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged SFPQ is approximately 0.3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SFPQ on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SFPQ on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-SFPQ antibody

Mouse monoclonal antibody raised against a partial recombinant SFPQ.

Product Categories/Family for anti-SFPQ antibody

Antibodies; Splicing Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4826998
• NCBI GeneID: 6421
• NCBI Accession #: NP_005057
• NCBI GenBank Nucleotide #: NM_005066
• UniProt Accession #: P23246; P30808; Q5SZ71
• Molecular Weight: 72,263 Da
• NCBI Official Full Name: splicing factor, proline- and glutamine-rich
• NCBI Official Synonym Full Names: splicing factor proline/glutamine-rich
• NCBI Official Symbol: SFPQ
• NCBI Official Synonym Symbols: PSF; POMP100; PPP1R140
• NCBI Protein Information: splicing factor, proline- and glutamine-rich; 100 kDa DNA-pairing protein; DNA-binding p52/p100 complex, 100 kDa subunit; PTB-associated splicing factor; PTB-associated-splicing factor; hPOMp100; polypyrimidine tract binding protein associated; polypyrimi
• UniProt Protein Name: Splicing factor, proline- and glutamine-rich
• Protein Family: Splicing factor
• UniProt Gene Name: SFPQ
• UniProt Synonym Gene Names: PSF; hPOMp100; PSF; PTB-associated-splicing factor
• UniProt Entry Name: SFPQ_HUMAN

Uniprot Description

PSF: a proline-and glutamine-rich splicing factor. Essential pre-mRNA splicing factor required early in spliceosome formation. Seems to also bind DNA. The active complex is a heterotetramer of two 52 kDa and two 100 kDa subunits. Reported to be a PKC-alpha-binding protein in the cell nucleus. Two alternatively spliced isoforms have been described.

Protein type: RNA splicing; RNA-binding; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: nucleoplasm; nuclear matrix; cytoplasm; nucleus; paraspeckles; chromatin

Molecular Function: protein binding; histone deacetylase binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; RNA splicing; rhythmic process; negative regulation of circadian rhythm; negative regulation of transcription from RNA polymerase II promoter; DNA repair; mRNA processing; negative regulation of transcription, DNA-dependent; regulation of circadian rhythm; DNA recombination