Mouse SFN Monoclonal Antibody | anti-SFN antibody

SFN (Stratifin, YWHAS) (HRP)

Cat. Num. AAA6181621

• Gene Names: SFN; YWHAS
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: SFN; Monoclonal Antibody; SFN (Stratifin; YWHAS) (HRP); Stratifin; YWHAS; anti-SFN antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G2
• Specificity: Recognizes SFN.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 248

• Applicable Applications for anti-SFN antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SFN (AAH00329.1, 1aa-248aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SFN monoclonal antibody (M02), clone 2G2. Western Blot analysis of SFN expression in U-2 OS (Cat # L022V1).)

Testing Data

(Detection limit for recombinant GST tagged SFN is approximately 0.03ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SFN on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SFN on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-SFN antibody

Antibodies; 14-3-3

NCBI and Uniprot Product Information

• NCBI GI #: 12653125
• NCBI GeneID: 2810
• NCBI Official Full Name: Stratifin
• NCBI Official Synonym Full Names: stratifin
• NCBI Official Symbol: SFN
• NCBI Official Synonym Symbols: YWHAS
• NCBI Protein Information: 14-3-3 protein sigma
• Protein Family: 14-3-3 protein

NCBI Description

This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. [provided by RefSeq, Aug 2017]