Mouse anti-Human SETDB1 Monoclonal Antibody | anti-SETDB1 antibody

SETDB1 (SET Domain Bifurcated 1, Histone-lysine N-methyltransferase SETDB1, ERG-associated Protein with SET Domain, ESET, Histone H3-K9 Methyltransferase 4, H3-K9-HMTase 4, KG1T, KIAA0067, Lysine N-methyltransferase 1E, KMT1E, TDRD21) (FITC)

Cat. Num. AAA6149606

• Gene Names: SETDB1; ESET; KG1T; KMT1E; TDRD21; H3-K9-HMTase4
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SETDB1; Monoclonal Antibody; SETDB1 (SET Domain Bifurcated 1; Histone-lysine N-methyltransferase SETDB1; ERG-associated Protein with SET Domain; ESET; Histone H3-K9 Methyltransferase 4; H3-K9-HMTase 4; KG1T; KIAA0067; Lysine N-methyltransferase 1E; KMT1E; TDRD21) (FITC); EC=2.1.1.43; anti-SETDB1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4A3
• Specificity: Recognizes human SETDB1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 4412

• Applicable Applications for anti-SETDB1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-100 from SETDB1 (NP_036564) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ASLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFY
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(SETDB1 monoclonal antibody Western Blot analysis of SETDB1 expression in SW-13)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SETDB1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SETDB1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SETDB1 antibody

Antibodies; Enzymes; Methyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 1677499399
• NCBI GeneID: 9869
• NCBI Accession #: NM_012432.4
• NCBI GenBank Nucleotide #: NM_012432
• UniProt Accession #: Q15047
• NCBI Official Full Name: Homo sapiens SET domain bifurcated histone lysine methyltransferase 1 (SETDB1), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: SET domain bifurcated histone lysine methyltransferase 1
• NCBI Official Symbol: SETDB1
• NCBI Official Synonym Symbols: ESET; KG1T; KMT1E; TDRD21; H3-K9-HMTase4
• NCBI Protein Information: histone-lysine N-methyltransferase SETDB1
• UniProt Protein Name: Histone-lysine N-methyltransferase SETDB1
• Protein Family: Histone-lysine N-methyltransferase
• UniProt Gene Name: SETDB1
• UniProt Synonym Gene Names: KIAA0067; KMT1E; ESET; H3-K9-HMTase 4
• UniProt Entry Name: SETB1_HUMAN

NCBI Description

This gene encodes a histone methyltransferase which regulates histone methylation, gene silencing, and transcriptional repression. This gene has been identified as a target for treatment in Huntington Disease, given that gene silencing and transcription dysfunction likely play a role in the disease pathogenesis. Alternatively spliced transcript variants of this gene have been described.[provided by RefSeq, Jun 2011]

Uniprot Description

SETDB1: a protein lysine methyltransferase that specifically trimethylates K9 of histone H3 (H3K9me3), a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Unlike SUV39H H3K9 methyltransferase, which functions mainly in heterochromatin regions such as pericentric heterochromatin, SETDB1 functions mainly in euchromatic regions, playing a central role in the silencing of euchromatic genes. H3K9me3 is coordinated with DNA methylation. Interacts with a variety of proteins, including transcription factors (ERG), histone deacetylases (HDAC1/2), DNA methyltransferases (DNMT3A/B) and transcriptional co-repressors (mSin3A/B, MBD1, KAP-1, the ATFa-associated modulator mAM). Its activity is dependent on MBD1 and is heritably maintained through DNA replication by being recruited by CAF-1. Contains Tudor and methyl-CpG-binding domains, which may coordinate binding to methylated histones and methylated DNA, respectively. Is targeted to histone H3 by TIF1B, a factor recruited by KRAB zinc-finger proteins. Recruited by DNMT3A to silenced promoters in cancer cells. May play a role in the pathogenesis of Huntington's disease, since levels of SETDB1 and H3K9me3 are both increased in diseased brains. Belongs to the histone-lysine methyltransferase family. Suvar3-9 subfamily. Three isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase; Methyltransferase, protein lysine; EC 2.1.1.43; Amino Acid Metabolism - lysine degradation

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; nuclear chromatin; plasma membrane; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; histone-lysine N-methyltransferase activity

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; inner cell mass cell proliferation