Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human SETDB1 Monoclonal Antibody | anti-SETDB1 antibody

SETDB1 (SET Domain Bifurcated 1, Histone-lysine N-methyltransferase SETDB1, ERG-associated Protein with SET Domain, ESET, Histone H3-K9 Methyltransferase 4, H3-K9-HMTase 4, KG1T, KIAA0067, Lysine N-methyltransferase 1E, KMT1E, TDRD21) (Biotin)

Gene Names
SETDB1; ESET; KG1T; KMT1E; TDRD21; H3-K9-HMTase4
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SETDB1; Monoclonal Antibody; SETDB1 (SET Domain Bifurcated 1; Histone-lysine N-methyltransferase SETDB1; ERG-associated Protein with SET Domain; ESET; Histone H3-K9 Methyltransferase 4; H3-K9-HMTase 4; KG1T; KIAA0067; Lysine N-methyltransferase 1E; KMT1E; TDRD21) (Biotin); EC=2.1.1.43; anti-SETDB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A3
Specificity
Recognizes human SETDB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
4412
Applicable Applications for anti-SETDB1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-100 from SETDB1 (NP_036564) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ASLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFY
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(SETDB1 monoclonal antibody Western Blot analysis of SETDB1 expression in SW-13)

Western Blot (WB) (SETDB1 monoclonal antibody Western Blot analysis of SETDB1 expression in SW-13)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SETDB1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SETDB1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SETDB1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SETDB1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SETDB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SET domain bifurcated histone lysine methyltransferase 1 (SETDB1), transcript variant 2, mRNA
NCBI Official Synonym Full Names
SET domain bifurcated histone lysine methyltransferase 1
NCBI Official Symbol
SETDB1
NCBI Official Synonym Symbols
ESET; KG1T; KMT1E; TDRD21; H3-K9-HMTase4
NCBI Protein Information
histone-lysine N-methyltransferase SETDB1
UniProt Protein Name
Histone-lysine N-methyltransferase SETDB1
UniProt Gene Name
SETDB1
UniProt Synonym Gene Names
KIAA0067; KMT1E; ESET; H3-K9-HMTase 4
UniProt Entry Name
SETB1_HUMAN

NCBI Description

This gene encodes a histone methyltransferase which regulates histone methylation, gene silencing, and transcriptional repression. This gene has been identified as a target for treatment in Huntington Disease, given that gene silencing and transcription dysfunction likely play a role in the disease pathogenesis. Alternatively spliced transcript variants of this gene have been described.[provided by RefSeq, Jun 2011]

Uniprot Description

SETDB1: a protein lysine methyltransferase that specifically trimethylates K9 of histone H3 (H3K9me3), a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Unlike SUV39H H3K9 methyltransferase, which functions mainly in heterochromatin regions such as pericentric heterochromatin, SETDB1 functions mainly in euchromatic regions, playing a central role in the silencing of euchromatic genes. H3K9me3 is coordinated with DNA methylation. Interacts with a variety of proteins, including transcription factors (ERG), histone deacetylases (HDAC1/2), DNA methyltransferases (DNMT3A/B) and transcriptional co-repressors (mSin3A/B, MBD1, KAP-1, the ATFa-associated modulator mAM). Its activity is dependent on MBD1 and is heritably maintained through DNA replication by being recruited by CAF-1. Contains Tudor and methyl-CpG-binding domains, which may coordinate binding to methylated histones and methylated DNA, respectively. Is targeted to histone H3 by TIF1B, a factor recruited by KRAB zinc-finger proteins. Recruited by DNMT3A to silenced promoters in cancer cells. May play a role in the pathogenesis of Huntington's disease, since levels of SETDB1 and H3K9me3 are both increased in diseased brains. Belongs to the histone-lysine methyltransferase family. Suvar3-9 subfamily. Three isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase; Methyltransferase, protein lysine; EC 2.1.1.43; Amino Acid Metabolism - lysine degradation

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; nuclear chromatin; plasma membrane; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; histone-lysine N-methyltransferase activity

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; inner cell mass cell proliferation

Research Articles on SETDB1

Similar Products

Product Notes

The SETDB1 setdb1 (Catalog #AAA6144303) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SETDB1 (SET Domain Bifurcated 1, Histone-lysine N-methyltransferase SETDB1, ERG-associated Protein with SET Domain, ESET, Histone H3-K9 Methyltransferase 4, H3-K9-HMTase 4, KG1T, KIAA0067, Lysine N-methyltransferase 1E, KMT1E, TDRD21) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SETDB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SETDB1 setdb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SETDB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.