Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SERPINB10 expression in transfected 293T cell line by SERPINB10 monoclonal antibody (M09), clone 2B8.Lane 1: SERPINB10 transfected lysate (Predicted MW: 45.4 KDa).Lane 2: Non-transfected lysate.)

Mouse SERPINB10 Monoclonal Antibody | anti-SERPINB10 antibody

SERPINB10 (Serpin Peptidase Inhibitor, Clade B (ovalbumin), Member 10, PI10, bomapin) (PE)

Gene Names
SERPINB10; PI10; PI-10
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
SERPINB10; Monoclonal Antibody; SERPINB10 (Serpin Peptidase Inhibitor; Clade B (ovalbumin); Member 10; PI10; bomapin) (PE); Serpin Peptidase Inhibitor; bomapin; anti-SERPINB10 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b, lambda
Clone Number
2B8
Specificity
Recognizes SERPINB10.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SERPINB10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SERPINB10 (NP_005015.1, 46aa-145aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AKGTTAAQMAQVLQFNRDQGVKCDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQPVNFVE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SERPINB10 expression in transfected 293T cell line by SERPINB10 monoclonal antibody (M09), clone 2B8.Lane 1: SERPINB10 transfected lysate (Predicted MW: 45.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SERPINB10 expression in transfected 293T cell line by SERPINB10 monoclonal antibody (M09), clone 2B8.Lane 1: SERPINB10 transfected lysate (Predicted MW: 45.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-SERPINB10 antibody
Mouse monoclonal antibody raised against a partial recombinant SERPINB10.
Product Categories/Family for anti-SERPINB10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,403 Da
NCBI Official Full Name
serpin B10
NCBI Official Synonym Full Names
serpin peptidase inhibitor, clade B (ovalbumin), member 10
NCBI Official Symbol
SERPINB10
NCBI Official Synonym Symbols
PI10; PI-10
NCBI Protein Information
serpin B10; bomapin; OTTHUMP00000066999; peptidase inhibitor 10; protease inhibitor 10 (ovalbumin type, bomapin); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 10
UniProt Protein Name
Serpin B10
Protein Family
UniProt Gene Name
SERPINB10
UniProt Synonym Gene Names
PI10
UniProt Entry Name
SPB10_HUMAN

NCBI Description

The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration. Serpins are characterized by a well-conserved tertiary structure that consists of 3 beta sheets and 8 or 9 alpha helices (Huber and Carrell, 1989 [PubMed 2690952]). A critical portion of the molecule, the reactive center loop connects beta sheets A and C. Protease inhibitor-10 (PI10; SERPINB10) is a member of the ov-serpin subfamily, which, relative to the archetypal serpin PI1 (MIM 107400), is characterized by a high degree of homology to chicken ovalbumin, lack of N- and C-terminal extensions, absence of a signal peptide, and a serine rather than an asparagine residue at the penultimate position (summary by Bartuski et al., 1997 [PubMed 9268635]).[supplied by OMIM]

Uniprot Description

SERPINB10: Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus. Belongs to the serpin family. Ov-serpin subfamily.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 18q21.3

Cellular Component: extracellular space; cytoplasm; nucleus

Molecular Function: serine-type endopeptidase inhibitor activity

Research Articles on SERPINB10

Similar Products

Product Notes

The SERPINB10 serpinb10 (Catalog #AAA6187899) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SERPINB10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SERPINB10 serpinb10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERPINB10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.