Mouse anti-Human SERCA3 Monoclonal Antibody | anti-SERCA3 antibody

SERCA3 (Sarcoplasmic/Endoplasmic Reticulum Calcium ATPase 3, ATP2A3, SR Ca(2+)-ATPase 3, Calcium Pump 3) (AP)

Cat. Num. AAA6133680

• Gene Names: ATP2A3; SERCA3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SERCA3; Monoclonal Antibody; SERCA3 (Sarcoplasmic/Endoplasmic Reticulum Calcium ATPase 3; ATP2A3; SR Ca(2+)-ATPase 3; Calcium Pump 3) (AP); anti-SERCA3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H3
• Specificity: Recognizes human ATP2A3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 4036

• Applicable Applications for anti-SERCA3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa501-620 from human ATP2A3 (AAH35729) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.94kD).)

Western Blot (WB)

(ATP2A3 monoclonal antibody, Western Blot analysis of ATP2A3 expression in HL-60.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ATP2A3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ATP2A3 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-SERCA3 antibody

Antibodies; Enzymes; ATPase

References

1. Expression of Sarco/Endoplasmic Reticulum Ca2+ATPase (SERCA) 3 proteins in two major conformational states in native human cell membranes. Corvazier E, Bredoux R, Kovacs T, Enouf J.Biochim Biophys Acta. 2009 Mar;1788(3):587-99. Epub 2008 Dec 16.

NCBI and Uniprot Product Information

• NCBI GI #: 23273018
• NCBI GeneID: 489
• NCBI Official Full Name: Homo sapiens ATPase, Ca++ transporting, ubiquitous, mRNA
• NCBI Official Synonym Full Names: ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
• NCBI Official Symbol: ATP2A3
• NCBI Official Synonym Symbols: SERCA3
• NCBI Protein Information: sarcoplasmic/endoplasmic reticulum calcium ATPase 3

NCBI Description

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]