Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RPA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Hela cell lysate)

Rabbit anti-Human RPA4 Polyclonal Antibody | anti-RPA4 antibody

RPA4 antibody - middle region

Gene Names
RPA4; HSU24186
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPA4; Polyclonal Antibody; RPA4 antibody - middle region; anti-RPA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD
Sequence Length
261
Applicable Applications for anti-RPA4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RPA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RPA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-RPA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Hela cell lysate)
Related Product Information for anti-RPA4 antibody
This is a rabbit polyclonal antibody against RPA4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1448 BC069824.1 1-1448
Product Categories/Family for anti-RPA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
replication protein A 30 kDa subunit
NCBI Official Synonym Full Names
replication protein A4
NCBI Official Symbol
RPA4
NCBI Official Synonym Symbols
HSU24186
NCBI Protein Information
replication protein A 30 kDa subunit
UniProt Protein Name
Replication protein A 30 kDa subunit
Protein Family
UniProt Gene Name
RPA4
UniProt Synonym Gene Names
RP-A p30
UniProt Entry Name
RFA4_HUMAN

NCBI Description

This gene encodes a single-stranded DNA-binding protein that is the 30-kDa subunit of the replication protein A complex. Replication protein A is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. The encoded protein localizes to DNA repair foci and may be involved in the cellular DNA damage response. This protein may also play a role in inhibiting viral replication.[provided by RefSeq, Apr 2010]

Uniprot Description

RPA4: functions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange. Component of the alternative replication protein A complex (aRPA) composed of RPA1, RPA3 and RPA4. Interacts with RPA1 and RPA3. Localizes to DNA repair foci after DNA damage.

Chromosomal Location of Human Ortholog: Xq21.33

Cellular Component: nucleoplasm; DNA replication factor A complex; nucleus

Molecular Function: single-stranded DNA binding

Biological Process: DNA replication initiation; nucleotide-excision repair; DNA damage checkpoint; DNA replication during S phase; mitotic cell cycle; G1/S transition of mitotic cell cycle; DNA recombination

Research Articles on RPA4

Similar Products

Product Notes

The RPA4 rpa4 (Catalog #AAA3211955) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPA4 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPA4 rpa4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPVSPSEVND AGDNDESHRN FIQDEVLRLI HECPHQEGKS IHELRAQLCD. It is sometimes possible for the material contained within the vial of "RPA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.