Mouse anti-Human SERCA1 Monoclonal Antibody | anti-SERCA1 antibody

SERCA1 (Sarcoplasmic/Endoplasmic Reticulum Calcium ATPase 1, ATP2A1, SR Ca(2+)-ATPase 1, Calcium Pump 1, Calcium-transporting ATPase Sarcoplasmic Reticulum Type, Fast Twitch Skeletal Muscle Isoform, Endoplasmic Reticulum Class 1/2 Ca(2+) ATPase) (PE)

Cat. Num. AAA6160194

• Gene Names: atp2a1; atp2a; atp2a2; serca1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SERCA1; Monoclonal Antibody; SERCA1 (Sarcoplasmic/Endoplasmic Reticulum Calcium ATPase 1; ATP2A1; SR Ca(2+)-ATPase 1; Calcium Pump 1; Calcium-transporting ATPase Sarcoplasmic Reticulum Type; Fast Twitch Skeletal Muscle Isoform; Endoplasmic Reticulum Class 1/2 Ca(2+) ATPase) (PE); anti-SERCA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B11
• Specificity: Recognizes human ATP2A1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SERCA1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa522-612 from human ATP2A1 (NP_775293) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB)

(Western Blot analysis of ATP2A1 expression in transfected 293T cell line by ATP2A1 monoclonal antibody. Lane 1: ATP2A1 transfected lysate (109.3kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ATP2A1 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ATP2A1 on A-431 cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ATP2A1 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-SERCA1 antibody

Antibodies; Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 147907326
• NCBI GeneID: 446229
• NCBI Accession #: NP_775293
• NCBI GenBank Nucleotide #: NM_173201
• UniProt Accession #: O14983
• Molecular Weight: Calculated MW 110kDa
• NCBI Official Full Name: ATPase, Ca++ transporting, slow twitch 2
• NCBI Official Synonym Full Names: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1<
• NCBI Official Symbol: atp2a1
• NCBI Official Synonym Symbols: atp2a; atp2a2; serca1
• NCBI Protein Information: ATPase, Ca++ transporting, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
• UniProt Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
• UniProt Gene Name: ATP2A1
• UniProt Synonym Gene Names: SERCA1
• UniProt Entry Name: AT2A1_HUMAN

Uniprot Description

ATP2A1: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Associated with sarcolipin (SLN) and phospholamban (PLN). Increased contractile activity leads to a decrease in SERCA1 expression, while decreased contractile activity leads to an increase in SERCA1 expression. Skeletal muscle, fast twitch muscle (type II) fibers. Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Endoplasmic reticulum; Hydrolase; Transporter, ion channel; EC 3.6.3.8; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16p12.1

Cellular Component: I band; endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; membrane; sarcoplasmic reticulum; perinuclear region of cytoplasm; integral to membrane; ER-Golgi intermediate compartment

Molecular Function: protein binding; protein homodimerization activity; calcium-transporting ATPase activity; calcium ion binding; ATP binding

Biological Process: apoptotic mitochondrial changes; positive regulation of fast-twitch skeletal muscle contraction; maintenance of mitochondrion localization; metabolic process; reduction of endoplasmic reticulum calcium ion concentration; calcium ion transport; elevation of endoplasmic reticulum calcium ion concentration; regulation of striated muscle contraction; blood coagulation; transmembrane transport; negative regulation of striated muscle contraction; elevation of mitochondrial calcium ion concentration

Disease: Brody Myopathy