<
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Mouse SEPT3 Monoclonal Antibody
SEPT3 (Neuronal-specific Septin-3, SEP3, SEPT3)
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SEPT3; Monoclonal Antibody; SEPT3 (Neuronal-specific Septin-3; SEP3; SEPT3); Anti -SEPT3 (Neuronal-specific Septin-3; anti-SEPT3 antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D8
Specificity
Recognizes human SEPT3. Species Crossreactivity: mouse and rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
Applicable Applications for anti-SEPT3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa236-346 from human SEPT3 (NP_663786) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(SEPT3 monoclonal antibody. Western Blot analysis of SEPT3 expression in PC-12.)
Western Blot (WB)
(SEPT3 monoclonal antibody. Western Blot analysis of SEPT3 expression in PC-12.)
Western Blot (WB)
(SEPT3 monoclonal antibody. Western Blot analysis of SEPT3 expression in Raw 264.7.)
Western Blot (WB)
(SEPT3 monoclonal antibody. Western Blot analysis of SEPT3 expression in Raw 264.7.)
Western Blot (WB)
(SEPT3 monoclonal antibody, Western Blot analysis of SEPT3 expression in Jurkat.)
Western Blot (WB)
(SEPT3 monoclonal antibody, Western Blot analysis of SEPT3 expression in Jurkat.)
Testing Data
(Detection limit for recombinant GST tagged SEPT3 is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SEPT3 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-SEPT3 antibody
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis.
Product Categories/Family for anti-SEPT3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
B.taurus DNA sequence 2 from patent application EP0238993
Similar Products
Product Notes
The SEPT3 (Catalog #AAA6000017) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEPT3 (Neuronal-specific Septin-3, SEP3, SEPT3) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SEPT3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SEPT3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TENDKIRQES MPFAVVGSDK EYQVNGKRVL GRKTPWGIIE VENLNHCEFA LLRDFVIRTH LQDLKEVTHN IHYETYRAKR LNDNGGLPPG EGLLGTVLPP VPATPCPTAE. It is sometimes possible for the material contained within the vial of "SEPT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
