Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse 2019-09-03 Monoclonal Antibody | anti-SEPT3 antibody

SEPT3 (Neuronal-specific Septin-3, SEP3, SEPT3) (AP)

Gene Names
SEPT3; SEP3; bK250D10.3
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
2019-09-03; Monoclonal Antibody; SEPT3 (Neuronal-specific Septin-3; SEP3; SEPT3) (AP); anti-SEPT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D8
Specificity
Recognizes human SEPT3. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SEPT3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa236-346 from human SEPT3 (NP_663786) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(SEPT3 monoclonal antibody. Western Blot analysis of SEPT3 expression in PC-12.)

Western Blot (WB) (SEPT3 monoclonal antibody. Western Blot analysis of SEPT3 expression in PC-12.)

Western Blot (WB)

(SEPT3 monoclonal antibody. Western Blot analysis of SEPT3 expression in Raw 264.7.)

Western Blot (WB) (SEPT3 monoclonal antibody. Western Blot analysis of SEPT3 expression in Raw 264.7.)

Western Blot (WB)

(SEPT3 monoclonal antibody, Western Blot analysis of SEPT3 expression in Jurkat.)

Western Blot (WB) (SEPT3 monoclonal antibody, Western Blot analysis of SEPT3 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged SEPT3 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SEPT3 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-SEPT3 antibody
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis.
Product Categories/Family for anti-SEPT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.1 kDa (381aa) confirmed by MALDI-TOF
NCBI Official Full Name
neuronal-specific septin-3 isoform A
NCBI Official Synonym Full Names
septin 3
NCBI Official Symbol
SEPT3
NCBI Official Synonym Symbols
SEP3; bK250D10.3
NCBI Protein Information
neuronal-specific septin-3
UniProt Protein Name
Neuronal-specific septin-3
UniProt Gene Name
SEPT3
UniProt Synonym Gene Names
SEP3
UniProt Entry Name
SEPT3_HUMAN

NCBI Description

This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

SEPT3: belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. This gene encodes three transcript variants resulting in three distinct isoforms.

Protein type: Hydrolase; Cytoskeletal; Cell cycle regulation

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: cytoskeleton; cytoplasm; synapse; cell junction

Molecular Function: GTP binding

Biological Process: cell division; cell cycle

Research Articles on SEPT3

Similar Products

Product Notes

The SEPT3 sept3 (Catalog #AAA6133673) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEPT3 (Neuronal-specific Septin-3, SEP3, SEPT3) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's 2019-09-03 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEPT3 sept3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2019-09-03, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.