Mouse anti-Human SEPHS2 Monoclonal Antibody | anti-SEPHS2 antibody

SEPHS2 (Selenophosphate Synthase 2, SPS2, SPS2b, Selenide, Water Dikinase 2, Selenium Donor Protein 2) (PE)

Cat. Num. AAA6160184

• Gene Names: SEPHS2; SPS2
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SEPHS2; Monoclonal Antibody; SEPHS2 (Selenophosphate Synthase 2; SPS2; SPS2b; Selenide; Water Dikinase 2; Selenium Donor Protein 2) (PE); EC=2.7.9.3; anti-SEPHS2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 2G9
• Specificity: Recognizes human SEPHS2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 2244

• Applicable Applications for anti-SEPHS2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa61-151 from SEPHS2 (NP_036380) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GCKVPQEALLKLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMM*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB)

(SEPHS2 monoclonal antibody Western Blot analysis of SEPHS2 expression in K-562)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SEPHS2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SEPHS2 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-SEPHS2 antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 1653962067
• NCBI GeneID: 22928
• NCBI Accession #: NM_012248.4
• NCBI GenBank Nucleotide #: NM_012248
• UniProt Accession #: Q99611
• NCBI Official Full Name: Homo sapiens selenophosphate synthetase 2 (SEPHS2), mRNA
• NCBI Official Synonym Full Names: selenophosphate synthetase 2
• NCBI Official Symbol: SEPHS2
• NCBI Official Synonym Symbols: SPS2
• NCBI Protein Information: selenide, water dikinase 2
• UniProt Protein Name: Selenide, water dikinase 2
• UniProt Gene Name: SEPHS2
• UniProt Synonym Gene Names: SPS2
• UniProt Entry Name: SPS2_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the production of monoselenophosphate (MSP) from selenide and ATP. MSP is the selenium donor required for synthesis of selenocysteine (Sec), which is co-translationally incorporated into selenoproteins at in-frame UGA codons that normally signal translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein is itself a selenoprotein containing a Sec residue at its active site, suggesting the existence of an autoregulatory mechanism. It is preferentially expressed in tissues implicated in the synthesis of selenoproteins and in sites of blood cell development. A pseudogene for this locus has been identified on chromosome 5. [provided by RefSeq, May 2017]