Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ACPP is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human Prostatic Acid Phosphatase Monoclonal Antibody | anti-PAP antibody

Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (Biotin)

Gene Names
ACP3; ACPP; 5'-NT; ACP-3; TM-PAP
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Prostatic Acid Phosphatase; Monoclonal Antibody; Prostatic Acid Phosphatase (PAP; ACPP; ACP3; ACP-3; 5'-Nucleotidase; 5'-NT; Ecto-5'-nucleotidase; Thiamine Monophosphatase; TMPase) (Biotin); anti-PAP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D11
Specificity
Recognizes human ACPP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1863
Applicable Applications for anti-PAP antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa310-418 from human ACPP (AAH07460) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELAGPVIPQDWSTECMTTNSHQVLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ACPP is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACPP is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PAP antibody
Respiratory syncytial virus (RSV) is the most significant respiratory pathogen of early development and causes about half of all cases of bronchiolitis and a quarter of all cases of pneumonia during the first few months of life. There are multiple types and subtypes of RSV. VP-R151 is a mixture of four antibodies to optimize sensitivity and detection of the various RSV forms. It does not cross- react with tissue culture isolates of influenza virus types A and B, parainfluenza virus types 1, 2, 3 and 4b, adeno- virus, herpes simplex virus types 1 and 2, varicella-zoster virus, cytomegalovirus, mumps virus, measles virus, ECHOvirus 19, coxsackie B4 virus, poliovirus types 1, 2 and 3 or negative tissue culture cells used in routine virus isolation.
Product Categories/Family for anti-PAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
55
NCBI Official Full Name
Homo sapiens acid phosphatase, prostate, mRNA
NCBI Official Synonym Full Names
acid phosphatase 3
NCBI Official Symbol
ACP3
NCBI Official Synonym Symbols
ACPP; 5'-NT; ACP-3; TM-PAP
NCBI Protein Information
prostatic acid phosphatase

NCBI Description

This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced transcript variant encoding a longer isoform has been found for this gene. This isoform contains a transmembrane domain and is localized in the plasma membrane-endosomal-lysosomal pathway. [provided by RefSeq, Sep 2008]

Research Articles on PAP

Similar Products

Product Notes

The PAP (Catalog #AAA6143762) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Prostatic Acid Phosphatase can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Prostatic Acid Phosphatase, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.