Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human Semaphorin 7A Monoclonal Antibody | anti-SEMA7A antibody

Semaphorin 7A (Semaphorin-7A, SEMA7A, CD108, CDw108, JMH Blood Group Antigen, John-Milton-Hargen Human Blood Group Ag, JMH, Semaphorin-K1, Sema K1, SEMAK1, Semaphorin-L, Sema L, SEMAL) (AP)

Gene Names
SEMA7A; JMH; CD108; SEMAL; CDw108; SEMAK1; H-Sema-L; H-SEMA-K1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Semaphorin 7A; Monoclonal Antibody; Semaphorin 7A (Semaphorin-7A; SEMA7A; CD108; CDw108; JMH Blood Group Antigen; John-Milton-Hargen Human Blood Group Ag; JMH; Semaphorin-K1; Sema K1; SEMAK1; Semaphorin-L; Sema L; SEMAL) (AP); H-Sema-L; H-SEMA-K1; anti-SEMA7A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D3
Specificity
Recognizes human SEMA7A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SEMA7A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa536-634 from SEMA7A (NP_003603) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Testing Data

(Detection limit for recombinant GST tagged SEMA7A is ~0.03ng/ml as a capture.)

Testing Data (Detection limit for recombinant GST tagged SEMA7A is ~0.03ng/ml as a capture.)
Product Categories/Family for anti-SEMA7A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95.7kDa (846aa) 70-100kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
semaphorin-7A isoform 1 preproprotein
NCBI Official Synonym Full Names
semaphorin 7A (John Milton Hagen blood group)
NCBI Official Symbol
SEMA7A
NCBI Official Synonym Symbols
JMH; CD108; SEMAL; CDw108; SEMAK1; H-Sema-L; H-SEMA-K1
NCBI Protein Information
semaphorin-7A
UniProt Protein Name
Semaphorin-7A
Protein Family
UniProt Gene Name
SEMA7A
UniProt Synonym Gene Names
CD108; SEMAL; Sema K1; Sema L
UniProt Entry Name
SEM7A_HUMAN

NCBI Description

This gene encodes a member of the semaphorin family of proteins. The encoded preproprotein is proteolytically processed to generate the mature glycosylphosphatidylinositol (GPI)-anchored membrane glycoprotein. The encoded protein is found on activated lymphocytes and erythrocytes and may be involved in immunomodulatory and neuronal processes. The encoded protein carries the John Milton Hagen (JMH) blood group antigens. Mutations in this gene may be associated with reduced bone mineral density (BMD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]

Uniprot Description

SEMA7A: Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes. Belongs to the semaphorin family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 15q22.3-q23

Cellular Component: membrane; plasma membrane; external side of plasma membrane

Molecular Function: integrin binding; protein binding; receptor activity

Biological Process: integrin-mediated signaling pathway; osteoblast differentiation; axon guidance; axon extension; positive regulation of axon extension; regulation of inflammatory response; immune response; olfactory lobe development; positive regulation of protein amino acid phosphorylation; inflammatory response

Disease: Blood Group, John Milton Hagen System

Research Articles on SEMA7A

Similar Products

Product Notes

The SEMA7A sema7a (Catalog #AAA6133663) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Semaphorin 7A (Semaphorin-7A, SEMA7A, CD108, CDw108, JMH Blood Group Antigen, John-Milton-Hargen Human Blood Group Ag, JMH, Semaphorin-K1, Sema K1, SEMAK1, Semaphorin-L, Sema L, SEMAL) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Semaphorin 7A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEMA7A sema7a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Semaphorin 7A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.