Mouse SEMA7A Monoclonal Antibody | anti-SEMA7A antibody

SEMA7A (Semaphorin 7A, GPI Membrane Anchor (John Milton Hagen Blood Group), CD108, CDw108, H-Sema-K1, H-Sema-L, JMH, MGC126692, MGC126696, SemaK1, SemaL) (FITC)

Cat. Num. AAA6178361

• Gene Names: SEMA7A; JMH; CD108; SEMAL; CDw108; SEMAK1; H-Sema-L; H-SEMA-K1
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: SEMA7A; Monoclonal Antibody; SEMA7A (Semaphorin 7A; GPI Membrane Anchor (John Milton Hagen Blood Group); CD108; CDw108; H-Sema-K1; H-Sema-L; JMH; MGC126692; MGC126696; SemaK1; SemaL) (FITC); Semaphorin 7A; SemaL; anti-SEMA7A antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G1
• Specificity: Recognizes SEMA7A.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-SEMA7A antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SEMA7A (NP_003603, 536aa-633aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SEMA7A is 1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SEMA7A on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SEMA7A on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-SEMA7A antibody

The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-SEMA7A antibody

Antibodies; Plexin; Semaphorin

NCBI and Uniprot Product Information

• NCBI GI #: 4504237
• NCBI GeneID: 8482
• NCBI Accession #: NP_003603
• NCBI GenBank Nucleotide #: NM_003612.4
• UniProt Accession #: O75326; Q1XE81; Q1XE82; Q1XE83; Q1XE84; Q3MIY5; B4DDP7; F5H1S0
• Molecular Weight: 95.7kDa (846aa) 70-100kDa (SDS-PAGE under reducing conditions)
• NCBI Official Full Name: semaphorin-7A isoform 1 preproprotein
• NCBI Official Synonym Full Names: semaphorin 7A (John Milton Hagen blood group)
• NCBI Official Symbol: SEMA7A
• NCBI Official Synonym Symbols: JMH; CD108; SEMAL; CDw108; SEMAK1; H-Sema-L; H-SEMA-K1
• NCBI Protein Information: semaphorin-7A
• UniProt Protein Name: Semaphorin-7A
• Protein Family: Semaphorin
• UniProt Gene Name: SEMA7A
• UniProt Synonym Gene Names: CD108; SEMAL; Sema K1; Sema L
• UniProt Entry Name: SEM7A_HUMAN

NCBI Description

This gene encodes a member of the semaphorin family of proteins. The encoded preproprotein is proteolytically processed to generate the mature glycosylphosphatidylinositol (GPI)-anchored membrane glycoprotein. The encoded protein is found on activated lymphocytes and erythrocytes and may be involved in immunomodulatory and neuronal processes. The encoded protein carries the John Milton Hagen (JMH) blood group antigens. Mutations in this gene may be associated with reduced bone mineral density (BMD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]

Uniprot Description

SEMA7A: Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes. Belongs to the semaphorin family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 15q22.3-q23

Cellular Component: membrane; plasma membrane; external side of plasma membrane

Molecular Function: integrin binding; protein binding; receptor activity

Biological Process: integrin-mediated signaling pathway; osteoblast differentiation; axon guidance; axon extension; positive regulation of axon extension; regulation of inflammatory response; immune response; olfactory lobe development; positive regulation of protein amino acid phosphorylation; inflammatory response

Disease: Blood Group, John Milton Hagen System