Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD).)

Mouse anti-Human SEC24D Monoclonal Antibody | anti-SEC24D antibody

SEC24D (SEC24-related Protein D, Protein Transport Protein Sec24D, KIAA0755) (AP)

Gene Names
SEC24D; CLCRP2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SEC24D; Monoclonal Antibody; SEC24D (SEC24-related Protein D; Protein Transport Protein Sec24D; KIAA0755) (AP); anti-SEC24D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A8
Specificity
Recognizes human SEC24D.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
4018
Applicable Applications for anti-SEC24D antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa935-1032 from SEC24D (NP_055637) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB)

(SEC24D monoclonal antibody Western Blot analysis of SEC24D expression in HeLa)

Western Blot (WB) (SEC24D monoclonal antibody Western Blot analysis of SEC24D expression in HeLa)
Product Categories/Family for anti-SEC24D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SEC24 homolog D, COPII coat complex component (SEC24D), transcript variant 1, mRNA
NCBI Official Synonym Full Names
SEC24 homolog D, COPII coat complex component
NCBI Official Symbol
SEC24D
NCBI Official Synonym Symbols
CLCRP2
NCBI Protein Information
protein transport protein Sec24D
UniProt Protein Name
Protein transport protein Sec24D
Protein Family
UniProt Gene Name
SEC24D
UniProt Synonym Gene Names
KIAA0755
UniProt Entry Name
SC24D_HUMAN

NCBI Description

The protein encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. This gene product is implicated in the shaping of the vesicle, and also in cargo selection and concentration. Mutations in this gene have been associated with Cole-Carpenter syndrome, a disorder affecting bone formation, resulting in craniofacial malformations and bones that break easily. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

Research Articles on SEC24D

Similar Products

Product Notes

The SEC24D sec24d (Catalog #AAA6133653) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEC24D (SEC24-related Protein D, Protein Transport Protein Sec24D, KIAA0755) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEC24D can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEC24D sec24d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SEC24D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.