Mouse anti-Human SCP2 Monoclonal Antibody | anti-SCP2 antibody

SCP2 (Non-specific Lipid-transfer Protein, Propanoyl-CoA C-acyltransferase, SCP-chi, SCPX, Sterol Carrier Protein 2, Sterol Carrier Protein X, DKFZp686C12188, DKFZp686D11188) (Biotin)

Cat. Num. AAA6144244

• Gene Names: SCP2; NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SCP2; Monoclonal Antibody; SCP2 (Non-specific Lipid-transfer Protein; Propanoyl-CoA C-acyltransferase; SCP-chi; SCPX; Sterol Carrier Protein 2; Sterol Carrier Protein X; DKFZp686C12188; DKFZp686D11188) (Biotin); anti-SCP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E9-1B3
• Specificity: Recognizes human SCP2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SCP2 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-144 from human SCP2 (AAH05911) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.84kD).)

Western Blot (WB)

(Western Blot analysis of SCP2 expression in transfected 293T cell line by SCP2 monoclonal antibody. Lane 1: SCP2 transfected lysate (35kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SCP2 transfected lysate using SCP2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SCP2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SCP2 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-SCP2 antibody

Antibodies; Enzymes; Acyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 13543502
• NCBI GeneID: 6342
• Molecular Weight: 56,497 Da
• NCBI Official Full Name: Homo sapiens sterol carrier protein 2, mRNA
• NCBI Official Synonym Full Names: sterol carrier protein 2
• NCBI Official Symbol: SCP2
• NCBI Official Synonym Symbols: NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI
• NCBI Protein Information: non-specific lipid-transfer protein
• Protein Family: SCP2 sterol-binding domain-containing protein

NCBI Description

This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.[provided by RefSeq, Aug 2010]