Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (41.84kD).)

Mouse anti-Human SCP2 Monoclonal Antibody | anti-SCP2 antibody

SCP2 (Non-specific Lipid-transfer Protein, Propanoyl-CoA C-acyltransferase, SCP-chi, SCPX, Sterol Carrier Protein 2, Sterol Carrier Protein X, DKFZp686C12188, DKFZp686D11188) (AP)

Gene Names
SCP2; NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCP2; Monoclonal Antibody; SCP2 (Non-specific Lipid-transfer Protein; Propanoyl-CoA C-acyltransferase; SCP-chi; SCPX; Sterol Carrier Protein 2; Sterol Carrier Protein X; DKFZp686C12188; DKFZp686D11188) (AP); anti-SCP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E9-1B3
Specificity
Recognizes human SCP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SCP2 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-144 from human SCP2 (AAH05911) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (41.84kD).)

Western Blot (WB)

(Western Blot analysis of SCP2 expression in transfected 293T cell line by SCP2 monoclonal antibody. Lane 1: SCP2 transfected lysate (35kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SCP2 expression in transfected 293T cell line by SCP2 monoclonal antibody. Lane 1: SCP2 transfected lysate (35kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SCP2 transfected lysate using SCP2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SCP2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SCP2 transfected lysate using SCP2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SCP2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SCP2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SCP2 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SCP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
56,497 Da
NCBI Official Full Name
Homo sapiens sterol carrier protein 2, mRNA
NCBI Official Synonym Full Names
sterol carrier protein 2
NCBI Official Symbol
SCP2
NCBI Official Synonym Symbols
NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI
NCBI Protein Information
non-specific lipid-transfer protein

NCBI Description

This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.[provided by RefSeq, Aug 2010]

Research Articles on SCP2

Similar Products

Product Notes

The SCP2 (Catalog #AAA6133638) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCP2 (Non-specific Lipid-transfer Protein, Propanoyl-CoA C-acyltransferase, SCP-chi, SCPX, Sterol Carrier Protein 2, Sterol Carrier Protein X, DKFZp686C12188, DKFZp686D11188) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCP2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.