Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SCGB3A1 is 1ng/ml as a capture antibody.)

Mouse anti-Human SCGB3A1 Monoclonal Antibody | anti-SCGB3A1 antibody

SCGB3A1 (Secretoglobin Family 3A Member 1, Cytokine HIN-1, High in Normal 1, HIN1, HIN-1, LU105, Pneumo Secretory Protein 2, PNSP2, PnSP-2, UNQ629/PRO1245, Uteroglobin-related Protein 2, UGRP2)

Gene Names
SCGB3A1; HIN1; HIN-1; LU105; UGRP2; PnSP-2
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SCGB3A1; Monoclonal Antibody; SCGB3A1 (Secretoglobin Family 3A Member 1; Cytokine HIN-1; High in Normal 1; HIN1; HIN-1; LU105; Pneumo Secretory Protein 2; PNSP2; PnSP-2; UNQ629/PRO1245; Uteroglobin-related Protein 2; UGRP2); Anti -SCGB3A1 (Secretoglobin Family 3A Member 1; anti-SCGB3A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G5
Specificity
Recognizes human SCGB3A1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG
Applicable Applications for anti-SCGB3A1 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Dilution: ELISA: 1ng/ml
Immunogen
Full length recombinant corresponding to aa1-105 from human SCGB3A1 (AAH29176) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SCGB3A1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SCGB3A1 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-SCGB3A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,100 Da
NCBI Official Full Name
secretoglobin family 3A member 1
NCBI Official Synonym Full Names
secretoglobin, family 3A, member 1
NCBI Official Symbol
SCGB3A1
NCBI Official Synonym Symbols
HIN1; HIN-1; LU105; UGRP2; PnSP-2
NCBI Protein Information
secretoglobin family 3A member 1; cytokine HIN-1; high in normal 1; cytokine high in normal-1; pneumo secretory protein 2; uteroglobin-related protein 2
UniProt Protein Name
Secretoglobin family 3A member 1
Protein Family
UniProt Gene Name
SCGB3A1
UniProt Synonym Gene Names
HIN1; PNSP2; UGRP2; PnSP-2
UniProt Entry Name
SG3A1_HUMAN

Uniprot Description

SCGB3A1: Potential growth inhibitory cytokine. Belongs to the secretoglobin family. UGRP subfamily.

Protein type: Secreted, signal peptide; Cytokine; Secreted

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: extracellular space

Molecular Function: cytokine activity

Biological Process: negative regulation of cell growth; regulation of cell proliferation

Research Articles on SCGB3A1

Similar Products

Product Notes

The SCGB3A1 scgb3a1 (Catalog #AAA6008395) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCGB3A1 (Secretoglobin Family 3A Member 1, Cytokine HIN-1, High in Normal 1, HIN1, HIN-1, LU105, Pneumo Secretory Protein 2, PNSP2, PnSP-2, UNQ629/PRO1245, Uteroglobin-related Protein 2, UGRP2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCGB3A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Dilution: ELISA: 1ng/ml. Researchers should empirically determine the suitability of the SCGB3A1 scgb3a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKLAALLGLC VALSCSSAAA FLVGSAKPVA QPVAALESAA EAGAGTLANP LGTLNPLKLL LSSLGIPVNH LIEGSQKCVA ELGPQAVGAV KALKALLGAL TVFG. It is sometimes possible for the material contained within the vial of "SCGB3A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.